PAH Recombinant monoclonal antibody, PBS Only (Capture)

PAH Uni-rAb® Recombinant Antibody for WB, IHC, Cytometric bead array, Indirect ELISA
Cat No. 86231-2-PBS
Clone No.251007A9

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Cytometric bead array, Indirect ELISA

EC:1.14.16.1, PH, Phe-4-monooxygenase, Phenylalanine-4-hydroxylase, PKU

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

86231-2-PBS targets PAH as part of a matched antibody pair:

MP02346-1: 86231-2-PBS capture and 86231-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag9541

Product name: Recombinant human PAH protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 177-452 aa of BC026251

Sequence: VEYMEEGKKTWGTVFKTLKSLYKTHACYEYNHIFPLLEKYCGFHEDNIPQLEDVSQFLQTCTGFRLRPVAGLLSSRDFLGGLAFRVFHCTQYIRHGSKPMYTPEPDICHELLGHVPLFSDRSFAQFSQEIGLASLGAPDEYIEKLATIYWFTVEFGLCKQGDSIKAYGAGLLSSFGELQYCLSEKPKLLPLELEKTAIQNYTVTEFQPLYYVAESFNDAKEKVRNFAATIPRPFSVRYDPYTQRIEVLDNTQQLKILADSINSEIGILCSALQKIK

Predict reactive species
Full Name phenylalanine hydroxylase
Calculated Molecular Weight 452 aa, 52 kDa
Observed Molecular Weight 52 kDa
GenBank Accession NumberBC026251
Gene Symbol PAH
Gene ID (NCBI) 5053
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP00439
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

PAH, also known as PH, belongs to the aromatic amino acid hydroxylase (AAAH) enzyme family. PAH catalyzes the conversion of L-phenylalanine (L-Phe) to L-tyrosine (L-Tyr) by para-hydroxylation of the aromatic side chain. PAH is primarily present in the liver, where removal of excess L-Phe prevents the neurotoxic effect of hyperphenylalaninemia (HPA). The calculated molecular weight of PAH is 52 kDa (PMID: 23457044).

Loading...
||
New chat Able
正在加载,请稍候...