PAH Recombinant monoclonal antibody, PBS Only (Capture)

• 

  WB analysis using 86231-2-RR (same clone as 86231-2-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 86231-2-RR (PAH antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86231-2-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 86231-2-RR (same clone as 86231-2-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 86231-2-RR (PAH antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 86231-2-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 86231-2-RR (same clone as 86231-2-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 86231-2-RR (PAH antibody) at dilution of 1:600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86231-2-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 86231-2-RR (same clone as 86231-2-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 86231-2-RR (PAH antibody) at dilution of 1:600 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 86231-2-PBS in a different storage buffer formulation.

• 

  Cytometric bead array sample test of MP02346-1

  The mean PAH concentration was determined to be 89.5 ng/mL in Hela cell extract based on a 0.9 mg/mL extract load.

• 

  Cytometric bead array standard curve of MP02346-1

  Cytometric bead array standard curve of MP02346-1, PAH Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 86231-2-PBS. Detection antibody: 86231-1-PBS. Standard: Ag9541. Range: 0.781-100 ng/mL.

• 

  Affinity and Kinetic Characterization of 86231-2-RR

  Biolayer interferometry (BLl) kinetic assays of 86231-2-RR against Human PAH were performed. The affinity constant is below 1 pM.

PAH Uni-rAb^® Recombinant Antibody for WB, IHC, Cytometric bead array, Indirect ELISA

Cat No. 86231-2-PBS

Clone No.251007A9

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Cytometric bead array, Indirect ELISA

Synonyms

EC:1.14.16.1, PH, Phe-4-monooxygenase, Phenylalanine-4-hydroxylase, PKU

---

Product Information

86231-2-PBS targets PAH as part of a matched antibody pair:

MP02346-1: 86231-2-PBS capture and 86231-1-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag9541

  Product name: Recombinant human PAH protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 177-452 aa of BC026251

  Sequence: VEYMEEGKKTWGTVFKTLKSLYKTHACYEYNHIFPLLEKYCGFHEDNIPQLEDVSQFLQTCTGFRLRPVAGLLSSRDFLGGLAFRVFHCTQYIRHGSKPMYTPEPDICHELLGHVPLFSDRSFAQFSQEIGLASLGAPDEYIEKLATIYWFTVEFGLCKQGDSIKAYGAGLLSSFGELQYCLSEKPKLLPLELEKTAIQNYTVTEFQPLYYVAESFNDAKEKVRNFAATIPRPFSVRYDPYTQRIEVLDNTQQLKILADSINSEIGILCSALQKIK

• Full Name: phenylalanine hydroxylase
• Calculated Molecular Weight: 452 aa, 52 kDa
• Observed Molecular Weight: 52 kDa
• GenBank Accession Number: BC026251
• Gene Symbol: PAH
• Gene ID (NCBI): 5053
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P00439
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PAH, also known as PH, belongs to the aromatic amino acid hydroxylase (AAAH) enzyme family. PAH catalyzes the conversion of L-phenylalanine (L-Phe) to L-tyrosine (L-Tyr) by para-hydroxylation of the aromatic side chain. PAH is primarily present in the liver, where removal of excess L-Phe prevents the neurotoxic effect of hyperphenylalaninemia (HPA). The calculated molecular weight of PAH is 52 kDa (PMID: 23457044).