PAICS Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PAICS Polyclonal antibody (12967-1-AP)

• Featured Product
• KD/KO Validated

PAICS Polyclonal Antibody for WB, IHC, ELISA

Cat No. 12967-1-AP Copied!

Publications (23)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Synonyms

ADE2, ADE2H1, AIR carboxylase, AIRC, Bifunctional phosphoribosylaminoimidazole carboxylase/phosphoribosylaminoimidazole succinocarboxamide synthetase

• 

  WB analysis using 12967-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12967-1-AP (PAICS antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse heart using 12967-1-AP

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 12967-1-AP (PAICS antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 12967-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 12967-1-AP (PAICS antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver using 12967-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 12967-1-AP (PAICS antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse liver using 12967-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 12967-1-AP (PAICS antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 12967-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 12967-1-AP (PAICS antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human testis using 12967-1-AP

  Immunohistochemical analysis of paraffin-embedded human testis using 12967-1-AP (PAICS antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of HeLa using 12967-1-AP

  1x10^6 HeLa cells were intracellularly stained with 0.25 ug PAICS Polyclonal antibody (12967-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for PAICS in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HL-60 cells, mouse heart tissue, HeLa cells, Jurkat cells, K-562 cells, Raji cells, THP-1 cells, mouse brain tissue
• Positive IHC detected in: human liver tissue, human testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12967-1-AP targets PAICS in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3621

  Product name: Recombinant human PAICS protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 75-425 aa of BC010273

  Sequence: AFTRKCGETAFIAPQCEMIPIEWVCRRIATGSFLKRNPGVKEGYKFYPPKVELFFKDDANNDPQWSEEQLIAAKFCFAGLLIGQTEVDIMSHATQAIFEILEKSWLPQNCTLVDMKIEFGVDVTTKEIVLADVIDNDSWRLWPSGDRSQQKDKQSYRDLKEVTPEGLQMVKKNFEWVAERVELLLKSESQCRVVVLMGSTSDLGHCEKIKKACGNFGIPCELRVTSAHKGPDETLRIKAEYEGDGIPTVFVAVAGRSNGLGPVMSGNTAYPVISCPPLTPDWGVQDVWSSLRLPSGLGCSTVLSPEGSAQFAAQIFGLSNHLVWSKLRASILNTWISLKQADKKIRECNL

• Full Name: phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase
• Calculated Molecular Weight: 425 aa, 47 kDa
• Observed Molecular Weight: 47 kDa
• GenBank Accession Number: BC010273
• Gene Symbol: PAICS
• Gene ID (NCBI): 10606
• RRID: AB_10638449
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P22234
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PAICS is also named as ADE2(Multifunctional protein), AIRC, PAIS. It is an important bifunctional enzyme in de novo purine biosynthesis in vertebrate with both 5-aminoimidazole ribonucleotide carboxylase (AIRc) and 4-(N-succinylcarboxamide)-5-aminoimidazole ribonucleotide synthetase (SAICARs) activities. It becomes an attractive target for rational anticancer drug design, since rapidly dividing cancer cells rely heavily on the purine de novo pathway for synthesis of adenine and guanine, whereas normal cells favor the salvage pathway(PMID:17224163).

Publications

What published studies show

The PAICS antibody (Cat# 12967-1-AP) has 23 total citations. Citations appear in journals including Cell, Nature Aging, Nature Communications, Molecular Cell, Journal of Clinical Investigation, Advanced Science, Cell Death & Differentiation, Clinical Cancer Research, NPJ Precision Oncology, Oncogene, and others. Research fields span de novo purine biosynthesis, cancer metabolism (lung, breast, pancreatic, renal cancers), senescence, brain development, and tumor microenvironment regulation.

Automatically generated from the 23 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse,human	WB	Cell; De novo and salvage purine synthesis pathways across tissues and tumors; Authors - Diem H Tran
		Nat Aging; The secreted metabolite sensor CtBP2 links metabolism to healthy lifespan; Authors - Motohiro Sekiya
human	WB,IP	Nat Commun; ACSS2 drives senescence-associated secretory phenotype by limiting purine biosynthesis through PAICS acetylation; Authors - Li Yang
		Mol Cell; Accumulation of succinate suppresses de novo purine synthesis through succinylation-mediated control of the mitochondrial folate cycle.; Authors - Mushtaq A. Nengroo
human	WB	Mol Cell; ERK2 Phosphorylates PFAS to Mediate Posttranslational Control of De Novo Purine Synthesis.; Authors - Eunus S Ali
human	WB	J Clin Invest; Therapeutic targeting of metabolic vulnerabilities in cancers with MLL3/4-COMPASS epigenetic regulator mutations; Authors - Zibo Zhao