PAICS Recombinant monoclonal antibody, PBS Only (Capture)

PAICS Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, Cytometric bead array, Sandwich ELISA, Indirect ELISA
Cat No. 86255-2-PBS
Clone No.250910H8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Cytometric bead array, Sandwich ELISA, Indirect ELISA

ADE2, ADE2H1, AIR carboxylase, AIRC, Bifunctional phosphoribosylaminoimidazole carboxylase/phosphoribosylaminoimidazole succinocarboxamide synthetase

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

86255-2-PBS targets PAICS as part of a matched antibody pair:

MP02343-1: 86255-2-PBS capture and 86255-1-PBS detection (validated in Cytometric bead array)

MP02343-2: 86255-2-PBS capture and 86255-4-PBS detection (validated in Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag3621

Product name: Recombinant human PAICS protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 75-425 aa of BC010273

Sequence: AFTRKCGETAFIAPQCEMIPIEWVCRRIATGSFLKRNPGVKEGYKFYPPKVELFFKDDANNDPQWSEEQLIAAKFCFAGLLIGQTEVDIMSHATQAIFEILEKSWLPQNCTLVDMKIEFGVDVTTKEIVLADVIDNDSWRLWPSGDRSQQKDKQSYRDLKEVTPEGLQMVKKNFEWVAERVELLLKSESQCRVVVLMGSTSDLGHCEKIKKACGNFGIPCELRVTSAHKGPDETLRIKAEYEGDGIPTVFVAVAGRSNGLGPVMSGNTAYPVISCPPLTPDWGVQDVWSSLRLPSGLGCSTVLSPEGSAQFAAQIFGLSNHLVWSKLRASILNTWISLKQADKKIRECNL

Predict reactive species
Full Name phosphoribosylaminoimidazole carboxylase, phosphoribosylaminoimidazole succinocarboxamide synthetase
Calculated Molecular Weight 425 aa, 47 kDa
Observed Molecular Weight 47 kDa
GenBank Accession NumberBC010273
Gene Symbol PAICS
Gene ID (NCBI) 10606
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP22234
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

PAICS is also named as ADE2(Multifunctional protein), AIRC, PAIS. It is an important bifunctional enzyme in de novo purine biosynthesis in vertebrate with both 5-aminoimidazole ribonucleotide carboxylase (AIRc) and 4-(N-succinylcarboxamide)-5-aminoimidazole ribonucleotide synthetase (SAICARs) activities. It becomes an attractive target for rational anticancer drug design, since rapidly dividing cancer cells rely heavily on the purine de novo pathway for synthesis of adenine and guanine, whereas normal cells favor the salvage pathway(PMID:17224163).

Loading...
||
New chat Able
正在加载,请稍候...