PAK7 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 82935-1-RR (same clone as 82935-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 82935-1-RR (PAK7 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 82935-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 82935-1-RR (same clone as 82935-1-PBS)

  WB result of PAK7 antibody (82935-1-RR; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-PAK7 transfected HeLa cells. This data was developed using the same antibody clone with 82935-1-PBS in a different storage buffer formulation.

• 

  FC experiment of K-562 using 82935-1-RR (same clone as 82935-1-PBS)

  (blue)1x10^6 K-562 cells were intracellularly stained with 0.25 ug Anti-Human PAK7 (82935-1-RR, Clone:230201A10) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:166(red), or 0.25 ug rabbit IgG isotype control. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 82935-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 82935-1-RR (same clone as 82935-1-PBS)

  (blue)1x10^6 HeLa cells were intracellularly stained with 0.25 ug Anti-Human PAK7 (82935-1-RR, Clone:230201A10) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:166(red), or 0.25 ug rabbit IgG isotype control. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 82935-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

PAK7 Uni-rAb^® Recombinant Antibody for WB, FC (Intra), Indirect ELISA

Cat No. 82935-1-PBS

Clone No.230201A10

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, FC (Intra), Indirect ELISA

Synonyms

PAK4/6/7, 230201A10, EC:2.7.11.1, KIAA1264, p21-activated kinase 5

---

Product Information

82935-1-PBS targets PAK7 in WB, FC (Intra), Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag29190

  Product name: Recombinant human PAK7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 180-360 aa of BC024179

  Sequence: AYYSEVKPLKSDFARFSADYHSHLDSLSKPSEYSDLKWEYQRASSSSPLDYSFQFTPSRTAGTSGCSKESLAYSESEWGPSLDDYDRRPKSSYLNQTSPQPTMRQRSRSGSGLQEPMMPFGASAFKTHPQGHSYNSYTYPRLSEPTMCIPKVDYDRAQMVLSPPLSGSDTYPRGPAKLPQS

• Full Name: p21 protein (Cdc42/Rac)-activated kinase 7
• Calculated Molecular Weight: 719 aa, 81 kDa
• Observed Molecular Weight: 70 kDa
• GenBank Accession Number: BC024179
• Gene Symbol: PAK7
• Gene ID (NCBI): 57144
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9P286
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PAK7, also known as PAK5, is a newly found but scarcely researched type II PAKs (PAK4, 5, 6). PAK7 was originally found in the brain, which promotes filopodia formation in nerve cells. Recently, studies have found that the expression level of PAK7 significantly increased in colorectal cancer, ovarian cancer, gastric cancer, neuroglioma, hepatocellular carcinoma, pancreatic cancer, osteosarcoma, and breast cancer. PAK7 plays an important role in tumorigenesis, invasion, and metastasis, mainly related to its mechanism of regulating cytoskeleton, inhibiting apoptosis, and promoting proliferation. The calculated molecular weight of PAK7 is 80 kDa (PMID: 29805709, PMID: 34165002).