• Featured Product
  • KD/KO Validated

PAK7 Recombinant monoclonal antibody

PAK7 Uni-rAb® Recombinant Antibody for WB, FC (Intra), ELISA
Cat No. 82935-1-RR
Clone No.230201A10

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, FC (Intra), ELISA

PAK4/6/7, 230201A10, EC:2.7.11.1, KIAA1264, p21-activated kinase 5

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, SH-SY5Y cells
Positive FC (Intra) detected inK-562 cells, HeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

82935-1-RR targets PAK7 in WB, FC (Intra), ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag29190

Product name: Recombinant human PAK7 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 180-360 aa of BC024179

Sequence: AYYSEVKPLKSDFARFSADYHSHLDSLSKPSEYSDLKWEYQRASSSSPLDYSFQFTPSRTAGTSGCSKESLAYSESEWGPSLDDYDRRPKSSYLNQTSPQPTMRQRSRSGSGLQEPMMPFGASAFKTHPQGHSYNSYTYPRLSEPTMCIPKVDYDRAQMVLSPPLSGSDTYPRGPAKLPQS

Predict reactive species
Full Name p21 protein (Cdc42/Rac)-activated kinase 7
Calculated Molecular Weight 719 aa, 81 kDa
Observed Molecular Weight70 kDa
GenBank Accession NumberBC024179
Gene Symbol PAK7
Gene ID (NCBI) 57144
RRIDAB_3670677
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9P286
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PAK7, also known as PAK5, is a newly found but scarcely researched type II PAKs (PAK4, 5, 6). PAK7 was originally found in the brain, which promotes filopodia formation in nerve cells. Recently, studies have found that the expression level of PAK7 significantly increased in colorectal cancer, ovarian cancer, gastric cancer, neuroglioma, hepatocellular carcinoma, pancreatic cancer, osteosarcoma, and breast cancer. PAK7 plays an important role in tumorigenesis, invasion, and metastasis, mainly related to its mechanism of regulating cytoskeleton, inhibiting apoptosis, and promoting proliferation. The calculated molecular weight of PAK7 is 80 kDa (PMID: 29805709, PMID: 34165002).

Protocols

Product Specific Protocols
FC protocol for PAK7 antibody 82935-1-RRDownload protocol
WB protocol for PAK7 antibody 82935-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...