Palladin Monoclonal antibody, PBS Only

• 

  WB analysis of human heart using 66601-1-Ig (same clone as 66601-1-PBS)

  Human heart tissue, pig heart tissue and rat heart tissue were subjected to SDS PAGE followed by western blot with 66601-1-Ig (Palladin antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66601-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 66601-1-Ig (same clone as 66601-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66601-1-Ig (Palladin antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66601-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon cancer using 66601-1-Ig (same clone as 66601-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66601-1-Ig (Palladin antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66601-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse testis using 66601-1-Ig (same clone as 66601-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse testis tissue using PALLD,palladin antibody (66601-1-Ig, Clone: 2A1F6 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66601-1-PBS in a different storage buffer formulation.

Palladin Monoclonal Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 66601-1-PBS

Clone No.2A1F6

Host / Isotype

Mouse / IgG2a

Reactivity

Human, rat, pig

Applications

WB, IHC, IF-P, Indirect ELISA

Synonyms

CGI 151, KIAA0992, palladin, PALLD, PALLD,palladin, PNCA1, Sarcoma antigen NY SAR 77, SIH002

---

Product Information

66601-1-PBS targets Palladin in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with Human, rat, pig samples.

• Tested Reactivity: Human, rat, pig
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1288

  Product name: Recombinant human PALLD,palladin protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 127-510 aa of BC013867

  Sequence: APFFEMKLKHYKIFEGMPVTFTCRVAGNPKPKIYWFKDGKQISPKSDHYTIQRDLDGTCSLHTTASTLDDDGNYTIMAANPQGRISCTGRLMVQAVNQRGRSPRSPSGHPHVRRPRSRSRDSGDENEPIQERFFRPHFLQAPGDLTVQEGKLCRMDCKVSGLPTPDLSWQLDGKPVRPDSAHKMLVRENGVHSLIIEPVTSRDAGIYTCIATNRAGQNSFSLELVVAAKEAHKPPVFIEKLQNTGVADGYPVRLECRVLGVPPPQIFWKKENESLTHSTDRVSMHQDNHGYICLLIQGATKEDAGWYTVSAKNEAGIVSCTARLDVYTQWHQQSQSTKPKKVRPSASRYAALSDQGLDIKAAFQPEANPSHLTLNTALVESEDL

• Full Name: palladin, cytoskeletal associated protein
• Calculated Molecular Weight: 1383 aa, 151 kDa
• Observed Molecular Weight: 151 kDa
• GenBank Accession Number: BC013867
• Gene Symbol: palladin
• Gene ID (NCBI): 23022
• RRID: AB_2881961
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8WX93
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.