Palladin Monoclonal antibody

• 

  WB analysis of human heart using 66601-1-Ig

  Human heart tissue, pig heart tissue and rat heart tissue were subjected to SDS PAGE followed by western blot with 66601-1-Ig (Palladin antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human colon cancer using 66601-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66601-1-Ig (Palladin antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human colon cancer using 66601-1-Ig

  Immunohistochemical analysis of paraffin-embedded human colon cancer tissue slide using 66601-1-Ig (Palladin antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse testis using 66601-1-Ig

  Immunofluorescent analysis of (4% PFA) fixed mouse testis tissue using PALLD,palladin antibody (66601-1-Ig, Clone: 2A1F6 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L).

Palladin Monoclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 66601-1-Ig

Clone No.2A1F6

Publications(1)

Host / Isotype

Mouse / IgG2a

Reactivity

Human, rat, pig and More (1)

Applications

WB, IHC, IF-P, ELISA

Synonyms

CGI 151, KIAA0992, palladin, PALLD, PALLD,palladin, PNCA1, Sarcoma antigen NY SAR 77, SIH002

---

Tested Applications

• Positive WB detected in: human heart tissue, pig heart tissue, rat heart tissue
• Positive IHC detected in: human colon cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse testis tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

66601-1-Ig targets Palladin in WB, IHC, IF-P, ELISA applications and shows reactivity with Human, rat, pig samples.

• Tested Reactivity: Human, rat, pig
• Cited Reactivity: human
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1288

  Product name: Recombinant human PALLD,palladin protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 127-510 aa of BC013867

  Sequence: APFFEMKLKHYKIFEGMPVTFTCRVAGNPKPKIYWFKDGKQISPKSDHYTIQRDLDGTCSLHTTASTLDDDGNYTIMAANPQGRISCTGRLMVQAVNQRGRSPRSPSGHPHVRRPRSRSRDSGDENEPIQERFFRPHFLQAPGDLTVQEGKLCRMDCKVSGLPTPDLSWQLDGKPVRPDSAHKMLVRENGVHSLIIEPVTSRDAGIYTCIATNRAGQNSFSLELVVAAKEAHKPPVFIEKLQNTGVADGYPVRLECRVLGVPPPQIFWKKENESLTHSTDRVSMHQDNHGYICLLIQGATKEDAGWYTVSAKNEAGIVSCTARLDVYTQWHQQSQSTKPKKVRPSASRYAALSDQGLDIKAAFQPEANPSHLTLNTALVESEDL

• Full Name: palladin, cytoskeletal associated protein
• Calculated Molecular Weight: 1383 aa, 151 kDa
• Observed Molecular Weight: 151 kDa
• GenBank Accession Number: BC013867
• Gene Symbol: palladin
• Gene ID (NCBI): 23022
• RRID: AB_2881961
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q8WX93
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cancer Med; Palladin promotes cancer stem cell-like properties in lung cancer by activating Wnt/Β-Catenin signaling; Authors - Xiong Shu