Tested Applications
| Positive WB detected in | HepG2 cells |
| Positive IHC detected in | human ovary cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:200-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 5 publications below |
| IHC | See 1 publications below |
Product Information
15321-1-AP targets PAM16 in WB, IHC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0970 Product name: Recombinant human PAM16 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-105 aa of BC005024 Sequence: MAKYLAQIIVMGVQVVGRAFARALRQEFAASRAAADARGRAGHRSAAASNLSGLSLQEAQQILNVSKLSPEEVQKNYEHLFKVNDKSVGGSFYLQSKVVRAKERP Predict reactive species |
| Full Name | mitochondria-associated protein involved in granulocyte-macrophage colony-stimulating factor signal transduction |
| Calculated Molecular Weight | 14 kDa |
| Observed Molecular Weight | 14 kDa |
| GenBank Accession Number | BC005024 |
| Gene Symbol | PAM16 |
| Gene ID (NCBI) | 51025 |
| RRID | AB_2878126 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9Y3D7 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
PAM16, also named as Magmas, TIM16 and TIMM16, is regulates ATP-dependent protein translocation into the mitochondrial matrix. The MW of PAM16 is about 14-16 kDa in WB detection. PAM16 is a component of the PAM complex at least composed of a mitochondrial HSP70 protein, GRPEL1 or GRPEL2, TIMM44, TIMM16/PAM16 and TIMM14/DNAJC19.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for PAM16 antibody 15321-1-AP | Download protocol |
| WB protocol for PAM16 antibody 15321-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nat Commun Protein import motor complex reacts to mitochondrial misfolding by reducing protein import and activating mitophagy | ||
Redox Biol Lead aggravates Alzheimer's disease pathology via mitochondrial copper accumulation regulated by COX17 | ||
Cancer Res Commun MAGMAS Inhibition Enhances Temozolomide Efficacy in Chemotherapy-Resistant Glioblastoma Models.
| ||
EMBO J A unified mechanism for mitochondrial damage sensing in PINK1-Parkin-mediated mitophagy. | ||
bioRxiv Novel reporter of the PINK1-Parkin mitophagy pathway identifies its damage sensor in the import gate |



