PAN3 Polyclonal antibody

• 

  WB analysis using 25655-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25655-1-AP (PAN3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human ovary cancer using 25655-1-AP

  Immunohistochemical analysis of paraffin-embedded human ovary cancer tissue slide using 25655-1-AP (PAN3 antibody) at dilution of 1:500 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

PAN3 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 25655-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

hPan3, PAB1P-dependent poly(A)-specific ribonuclease, PAN deadenylation complex subunit 3, PAN2-PAN3 deadenylation complex subunit PAN3, Poly(A)-nuclease deadenylation complex subunit 3

---

Tested Applications

• Positive WB detected in: HeLa cells, Jurkat cells, NIH/3T3 cells
• Positive IHC detected in: human ovary cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25655-1-AP targets PAN3 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag22559

  Product name: Recombinant human PAN3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 512-687 aa of BC128180

  Sequence: KAMELVTINYSSDLKNLILYLLTDQNRMRSVNDIMPMIGARFYTQLDAAQMRNDVIEEDLAKEVQNGRLFRLLAKLGTINERPEFQKDPTWSETGDRYLLKLFRDHLFHQVTEAGAPWIDLSHIISCLNKLDAGVPEKISLISRDEKSVLVVTYSDLKRCFENTFQELIAAANGQL

• Full Name: PAN3 poly(A) specific ribonuclease subunit homolog (S. cerevisiae)
• Calculated Molecular Weight: 887 aa, 96 kDa
• Observed Molecular Weight: 90-100kDa; 65-68 kDa
• GenBank Accession Number: BC128180
• Gene Symbol: PAN3
• Gene ID (NCBI): 255967
• RRID: AB_3669491
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q58A45
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Shortening of the poly(A) tail in mRNA, called deadenylation, is the first rate-limiting step in mRNA turnover. PAN3 is the regulatory subunit of a cytoplasmic poly(A) nuclease complex that links the catalytic PAN2 subunit to the poly(A)-binding protein PABP, which stimulates PAN2-dependent deadenylation activity (PMID: 14583602). PAN3 has four isoforms, isoform1: 95 kDa; isoform2: 64 kDa, isoform3: 89 kDa and isoform4: 72 kDa. This antibody recognizes isoform 1/2/3.