PANX1 Monoclonal antibody, PBS Only

• 

  WB analysis using 68873-5-Ig (same clone as 68873-5-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68873-5-Ig (PANX1 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68873-5-PBS in a different storage buffer formulation.

• 

  WB analysis of Neuro-2a using 68873-5-Ig (same clone as 68873-5-PBS)

  Neuro-2a cells were subjected to SDS PAGE followed by western blot with 68873-5-Ig (PANX1 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68873-5-PBS in a different storage buffer formulation.

PANX1 Monoclonal Antibody for WB, Indirect ELISA

Cat No. 68873-5-PBS

Clone No.3G4B10

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

Caspase-activated pannexin-1, Innexin, MRS1, OOMD7, OZEMA7

---

Product Information

68873-5-PBS targets PANX1 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag33689

  Product name: Recombinant human PANX1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 126-426 aa of BC016931

  Sequence: FWRFAAAPHICSDLKFIMEELDKVYNRAIKAAKSARDLDMRDGACSVPGVTENLGQSLWEVSESHFKYPIVEQYLKTKKNSNNLIIKYISCRLLTLIIILLACIYLGYYFSLSSLSDEFVCSIKSGILRNDSTVPDQFQCKLIAVGIFQLLSVINLVVYVLLAPVVVYTLFVPFRQKTDVLKVYEILPTFDVLHFKSEGYNDLSLYNLFLEENISEVKSYKCLKVLENIKSSGQGIDPMLLLTNLGMIKMDVVDGKTPMSAEMREEQGNQTAELQGMNIDSETKANNGEKNARQRLLDSSC

• Full Name: pannexin 1
• Calculated Molecular Weight: 426 aa, 48 kDa
• Observed Molecular Weight: 45-50 kDa
• GenBank Accession Number: BC016931
• Gene Symbol: PANX1
• Gene ID (NCBI): 24145
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q96RD7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PANX1, also named as MRS1, belongs to the pannexin family. It plays a role as a Ca2+-leak channel to regulate ER Ca2+ homeostasis. It is a structural component of the gap junctions and the hemichannels. PANX1 induced the formation of intercellular channels with characteristics of gap junctions. PANX1 is 48-kDa protein which contains 4 transmembrane domains and cytoplasmic N and C termini. It is a mediator of find-me signal/nucleotide release from apoptotic cells.