PANX1 Monoclonal antibody

• 

  WB analysis using 68873-5-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 68873-5-Ig (PANX1 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Neuro-2a using 68873-5-Ig

  Neuro-2a cells were subjected to SDS PAGE followed by western blot with 68873-5-Ig (PANX1 antibody) at dilution of 1:20000 incubated at room temperature for 1.5 hours.

PANX1 Monoclonal Antibody for WB, ELISA

Cat No. 68873-5-Ig

Clone No.3G4B10

Host / Isotype

Mouse / IgG2a

Reactivity

human, mouse

Applications

WB, ELISA

Synonyms

Caspase-activated pannexin-1, Innexin, MRS1, OOMD7, OZEMA7

---

Tested Applications

• Positive WB detected in: SCaBER cells, MDA-MB-231 cells, HaCaT cells, SH-SY5Y cells, Jurkat cells, K-562 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

68873-5-Ig targets PANX1 in WB, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag33689

  Product name: Recombinant human PANX1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 126-426 aa of BC016931

  Sequence: FWRFAAAPHICSDLKFIMEELDKVYNRAIKAAKSARDLDMRDGACSVPGVTENLGQSLWEVSESHFKYPIVEQYLKTKKNSNNLIIKYISCRLLTLIIILLACIYLGYYFSLSSLSDEFVCSIKSGILRNDSTVPDQFQCKLIAVGIFQLLSVINLVVYVLLAPVVVYTLFVPFRQKTDVLKVYEILPTFDVLHFKSEGYNDLSLYNLFLEENISEVKSYKCLKVLENIKSSGQGIDPMLLLTNLGMIKMDVVDGKTPMSAEMREEQGNQTAELQGMNIDSETKANNGEKNARQRLLDSSC

• Full Name: pannexin 1
• Calculated Molecular Weight: 426 aa, 48 kDa
• Observed Molecular Weight: 45-50 kDa
• GenBank Accession Number: BC016931
• Gene Symbol: PANX1
• Gene ID (NCBI): 24145
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q96RD7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PANX1, also named as MRS1, belongs to the pannexin family. It plays a role as a Ca2+-leak channel to regulate ER Ca2+ homeostasis. It is a structural component of the gap junctions and the hemichannels. PANX1 induced the formation of intercellular channels with characteristics of gap junctions. PANX1 is 48-kDa protein which contains 4 transmembrane domains and cytoplasmic N and C termini. It is a mediator of find-me signal/nucleotide release from apoptotic cells.