PAPLN Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PAPLN Polyclonal antibody (31937-1-AP)

• 

  WB analysis using 31937-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31937-1-AP (PAPLN antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

PAPLN Polyclonal Antibody for WB, ELISA

Cat No. 31937-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

Papilin, UNQ2420/PRO4977

---

Tested Applications

• Positive WB detected in: Daudi cells, Raji cells, Ramos cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31937-1-AP targets PAPLN in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag36224

  Product name: Recombinant human PAPLN protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 760-870 aa of BC136623

  Sequence: HGSCADWAARWYFVASVGQCNRFWYGGCHGNANNFASEQECMSSCQGSLHGPRRPQPGASGRSTHTDGGGSSPAGEQEPSQHRTGAAVQRKPWPSGGLWRQDQQPGPGEAP

• Full Name: papilin, proteoglycan-like sulfated glycoprotein
• Calculated Molecular Weight: 137 kDa / 119 kDa
• Observed Molecular Weight: 120 kDa
• GenBank Accession Number: BC136623
• Gene Symbol: PAPLN
• Gene ID (NCBI): 89932
• RRID: AB_3742497
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: O95428
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PAPLN (papilin, proteoglycan like sulfated glycoprotein) is a protein-coding gene located on human chromosome 14q24.2 that encodes a secreted glycoprotein belonging to the papilin family . Predicted to function as a serine-type endopeptidase inhibitor, PAPLN contains multiple conserved domains including thrombospondin type 1 repeats, Kunitz/BPTI domains, and immunoglobulin-like domains, which are characteristic of protease inhibitors involved in extracellular matrix organization . The protein is primarily localized to the basement membrane and plays a role in extracellular matrix organization and nervous system development . PAPLN is broadly expressed across human tissues, with highest expression levels observed in the spleen and kidney . Emerging research suggests its involvement in pelvic organ prolapse etiopathogenesis, highlighting its potential significance in connective tissue integrity .