PARN Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• PARN Recombinant monoclonal antibody, PBS Only (85408-5-PBS)

• 

  WB analysis using 85408-5-RR (same clone as 85408-5-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85408-5-RR (PARN antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85408-5-PBS in a different storage buffer formulation.

• 

  IHC staining of Human Breast Cancer(Her2+;ER-;PR-) using 85408-5-RR (same clone as 85408-5-PBS)

  Immunohistochemical analysis of paraffin-embedded Human Breast Cancer(Her2+;ER-;PR-) slide using 85408-5-RR (PARN antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85408-5-PBS in a different storage buffer formulation.

• 

  IHC staining of Human Breast Cancer(Her2+;ER-;PR-) using 85408-5-RR (same clone as 85408-5-PBS)

  Immunohistochemical analysis of paraffin-embedded Human Breast Cancer(Her2+;ER-;PR-) slide using 85408-5-RR (PARN antibody) at dilution of 1:1000 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 85408-5-PBS in a different storage buffer formulation.

• 

  FC experiment of A431 using 85408-5-RR (same clone as 85408-5-PBS)

  1x10^6 A431 cells were intracellularly stained with 0.25 ug PARN Recombinant monoclonal antibody (85408-5-RR, Clone:242993F5) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Isotype Control (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 85408-5-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 85408-5-RR

  Biolayer interferometry (BLl) kinetic assays of 85408-5-RR against Human PARN were performed. The affinity constant is 96.9 pM.

PARN Uni-rAb^® Recombinant Antibody for WB, IHC, FC (Intra), Indirect ELISA

Cat No. 85408-5-PBS

Clone No.242993F5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, FC (Intra), Indirect ELISA

Synonyms

242993F5, DAN, EC:3.1.13.4, Poly(A)-specific ribonuclease PARN, Polyadenylate-specific ribonuclease

---

Product Information

85408-5-PBS targets PARN in WB, IHC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag4774

  Product name: Recombinant human PARN protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-347 aa of BC050029

  Sequence: MEIIRSNFKSNLHKVYQAIEEADFFAIDGEFSGISDGPSVSALTNGFDTPEERYQKLKKHSMDFLLFQFGLCTFKYDYTDSKYITKSFNFYVFPKPFNRSSPDVKFVCQSSSIDFLASQGFDFNKVFRNGIPYLNQEEERQLREQYDEKRSQANGAGALSYVSPNTSKCPVTIPEDQKKFIDQVVEKIEDLLQSEENKNLDLEPCTGFQRKLIYQTLSWKYPKGIHVETLETEKKERYIVISKVDEEERKRREQQKHAKEQEELNDAVGFSRVIHAIANSGKLVIGHNMLLDVMHTVHQFYCPLPADLSEFKEMTTCVFPRLLDTKLMASTQPFKDIINNTSLAELE

• Full Name: poly(A)-specific ribonuclease (deadenylation nuclease)
• Calculated Molecular Weight: 639 aa, 73 kDa
• Observed Molecular Weight: 74 kDa
• GenBank Accession Number: BC050029
• Gene Symbol: PARN
• Gene ID (NCBI): 5073
• RRID: AB_3744201
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O95453
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Poly(A)-specific ribonuclease (PARN) is a deadenylase enzyme that is present in mammalian cells. As a deadenylase, PARN interacts with the cap and the poly(A) tail of mRNA to control the length of the poly(A) tail and regulate gene expression. Therefore, it plays a role in mRNA degradation in the nucleus and cytoplasm.