PARP11 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PARP11 Polyclonal antibody (16692-1-AP)

• Featured Product
• KD/KO Validated

PARP11 Polyclonal Antibody for WB, ELISA

Cat No. 16692-1-AP Copied!

Publications (3)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IF, ELISA

Synonyms

ADP-ribosyltransferase diphtheria toxin-like 11, ARTD11, C12orf6, EC:2.4.2.-, MIB006

• 

  WB analysis using 16692-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16692-1-AP (PARP11 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 16692-1-AP

  WB result of PARP11 antibody (16692-1-AP; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-PARP11 transfected HeLa cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 16692-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16692-1-AP (PARP11 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of PC-3 using 16692-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 16692-1-AP (PARP11 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for PARP11 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HeLa cells, HEK-293T cells, IFN beta treated HEK-293T cells, PC-3 cells, mouse heart tissue, mouse spleen tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16692-1-AP targets PARP11 in WB, IF, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10053

  Product name: Recombinant human PARP11 protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 1-331 aa of BC017569

  Sequence: MFHKAEELFSKTTNNEVDDMDTSDTQWGWFYLAECGKWHMFQPDTNSQCSVSSEDIEKSFKTNPCGSISFTTSKFSYKIDFAEMKQMNLTTGKQRLIKRAPFSISAFSYICENEAIPMPPHWENVNTQVPYQLIPLHNQTHEYNEVANLFGKTMDRNRIKRIQRIQNLDLWEFFCRKKAQLKKKRGVPQINEQMLFHGTSSEFVEAICIHNFDWRINGIHGAVFGKGTYFARDAAYSSRFCKDDIKHGNTFQIHGVSLQQRHLFRTYKSMFLARVLIGDYINGDSKYMRPPSKDGSYVNLYDSCVDDTWNPKIFVVFDANQIYPEYLIDFH

• Full Name: poly (ADP-ribose) polymerase family, member 11
• Calculated Molecular Weight: 331 aa, 39 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC017569
• Gene Symbol: PARP11
• Gene ID (NCBI): 57097
• RRID: AB_2158504
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NR21
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PARP11, also named as ARTD11, belongs to the  ARTD/PARP family. PARP11 is a mono-ADP-ribosyltransferase that mediates mono-ADP-ribosylation of target proteins. PARP11 plays a role in nuclear envelope stability and nuclear remodeling during spermiogenesis (PMID: 25043379). PARP11 has 4 isoforms with the molecular mass of 28-40 kDa.

Publications

What published studies show

The PARP11 Polyclonal antibody (Cat# 16692-1-AP) has 3 citations. These appear in Ecotoxicology and Environmental Safety, Frontiers in Cellular and Infection Microbiology, and Nucleic Acids Research. The associated research fields include ecotoxicology (PFOA exposure effects on sperm), virology (pseudorabies virus restriction), and molecular biology (viral RNA ribosylation in mammalian cells). Applications cited include WB and IF, with species spanning mouse, pig, and human.

Automatically generated from the 3 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Ecotoxicol Environ Saf; PFOA exposure decreases acrosome reaction and increases DNA oxidative damage by impairing the sperm head shaping in mice.; Authors - Chuan Wang
pig,human	WB,IF	Front Cell Infect Microbiol; Identification of porcine PARP11 as a restricted factor for pseudorabies virus; Authors - Chunyun Qi ; KD Validated
		Nucleic Acids Res; Functional roles for viral RNA ribosylation in mammalian cells.; Authors - John D Sears