• Featured Product
  • KD/KO Validated

PARP11 Polyclonal antibody

PARP11 Polyclonal Antibody for WB, IHC, ELISA
Cat No. 16692-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF, ELISA

ADP-ribosyltransferase diphtheria toxin-like 11, ARTD11, C12orf6, EC:2.4.2.-, MIB006

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, PC-3 cells, mouse heart tissue, mouse spleen tissue
Positive IHC detected inhuman kidney tissue, human placenta tissue, human colon tissue, human testis tissue, human skin tissue, human liver tissue, human ovary tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

16692-1-AP targets PARP11 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Cited Reactivityhuman, pig
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag10053

Product name: Recombinant human PARP11 protein

Source: e coli.-derived, T-HIS

Tag: 6*His

Domain: 1-331 aa of BC017569

Sequence: MFHKAEELFSKTTNNEVDDMDTSDTQWGWFYLAECGKWHMFQPDTNSQCSVSSEDIEKSFKTNPCGSISFTTSKFSYKIDFAEMKQMNLTTGKQRLIKRAPFSISAFSYICENEAIPMPPHWENVNTQVPYQLIPLHNQTHEYNEVANLFGKTMDRNRIKRIQRIQNLDLWEFFCRKKAQLKKKRGVPQINEQMLFHGTSSEFVEAICIHNFDWRINGIHGAVFGKGTYFARDAAYSSRFCKDDIKHGNTFQIHGVSLQQRHLFRTYKSMFLARVLIGDYINGDSKYMRPPSKDGSYVNLYDSCVDDTWNPKIFVVFDANQIYPEYLIDFH

Predict reactive species
Full Name poly (ADP-ribose) polymerase family, member 11
Calculated Molecular Weight 331 aa, 39 kDa
Observed Molecular Weight 30 kDa
GenBank Accession NumberBC017569
Gene Symbol PARP11
Gene ID (NCBI) 57097
RRIDAB_2158504
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9NR21
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PARP11, also named as ARTD11, belongs to the  ARTD/PARP family. PARP11 is a mono-ADP-ribosyltransferase that mediates mono-ADP-ribosylation of target proteins. PARP11 plays a role in nuclear envelope stability and nuclear remodeling during spermiogenesis (PMID: 25043379). PARP11 has 4 isoforms with the molecular mass of 28-40 kDa.

Protocols

Product Specific Protocols
IHC protocol for PARP11 antibody 16692-1-APDownload protocol
WB protocol for PARP11 antibody 16692-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
pig,humanWB,IF

Front Cell Infect Microbiol

Identification of porcine PARP11 as a restricted factor for pseudorabies virus

Authors - Chunyun Qi
  • KD Validated
Loading...
||
New chat Able
正在加载,请稍候...