PARP11 Polyclonal antibody

• 

  WB analysis using 16692-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16692-1-AP (PARP11 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 16692-1-AP

  WB result of PARP11 antibody (16692-1-AP; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-PARP11 transfected HeLa cells.

• 

  WB analysis using 16692-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16692-1-AP (PARP11 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of PC-3 using 16692-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 16692-1-AP (PARP11 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• Featured Product
• KD/KO Validated

PARP11 Polyclonal Antibody for WB, ELISA

Cat No. 16692-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IF, ELISA

Synonyms

ADP-ribosyltransferase diphtheria toxin-like 11, ARTD11, C12orf6, EC:2.4.2.-, MIB006

---

Tested Applications

• Positive WB detected in: HeLa cells, HEK-293T cells, IFN beta treated HEK-293T cells, PC-3 cells, mouse heart tissue, mouse spleen tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 1 publications below
• IF: See 1 publications below

Product Information

16692-1-AP targets PARP11 in WB, IF, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10053

  Product name: Recombinant human PARP11 protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 1-331 aa of BC017569

  Sequence: MFHKAEELFSKTTNNEVDDMDTSDTQWGWFYLAECGKWHMFQPDTNSQCSVSSEDIEKSFKTNPCGSISFTTSKFSYKIDFAEMKQMNLTTGKQRLIKRAPFSISAFSYICENEAIPMPPHWENVNTQVPYQLIPLHNQTHEYNEVANLFGKTMDRNRIKRIQRIQNLDLWEFFCRKKAQLKKKRGVPQINEQMLFHGTSSEFVEAICIHNFDWRINGIHGAVFGKGTYFARDAAYSSRFCKDDIKHGNTFQIHGVSLQQRHLFRTYKSMFLARVLIGDYINGDSKYMRPPSKDGSYVNLYDSCVDDTWNPKIFVVFDANQIYPEYLIDFH

• Full Name: poly (ADP-ribose) polymerase family, member 11
• Calculated Molecular Weight: 331 aa, 39 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC017569
• Gene Symbol: PARP11
• Gene ID (NCBI): 57097
• RRID: AB_2158504
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NR21
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PARP11, also named as ARTD11, belongs to the  ARTD/PARP family. PARP11 is a mono-ADP-ribosyltransferase that mediates mono-ADP-ribosylation of target proteins. PARP11 plays a role in nuclear envelope stability and nuclear remodeling during spermiogenesis (PMID: 25043379). PARP11 has 4 isoforms with the molecular mass of 28-40 kDa.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
pig,human	WB,IF	Front Cell Infect Microbiol; Identification of porcine PARP11 as a restricted factor for pseudorabies virus; Authors - Chunyun Qi ; KD Validated