PARP11 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PARP11 Polyclonal antibody, PBS Only (16692-1-PBS)

• 

  WB analysis using 16692-1-AP (same clone as 16692-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 16692-1-AP (PARP11 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16692-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 16692-1-AP (same clone as 16692-1-PBS)

  WB result of PARP11 antibody (16692-1-AP; 1:600; incubated at room temperature for 1.5 hours) with sh-Control and sh-PARP11 transfected HeLa cells. This data was developed using the same antibody clone with 16692-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 16692-1-AP (same clone as 16692-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 16692-1-AP (PARP11 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16692-1-PBS in a different storage buffer formulation.

• 

  WB analysis of PC-3 using 16692-1-AP (same clone as 16692-1-PBS)

  PC-3 cells were subjected to SDS PAGE followed by western blot with 16692-1-AP (PARP11 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16692-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

PARP11 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 16692-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

ADP-ribosyltransferase diphtheria toxin-like 11, ARTD11, C12orf6, EC:2.4.2.-, MIB006

---

Product Information

16692-1-PBS targets PARP11 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10053

  Product name: Recombinant human PARP11 protein

  Source: e coli.-derived, T-HIS

  Tag: 6*His

  Domain: 1-331 aa of BC017569

  Sequence: MFHKAEELFSKTTNNEVDDMDTSDTQWGWFYLAECGKWHMFQPDTNSQCSVSSEDIEKSFKTNPCGSISFTTSKFSYKIDFAEMKQMNLTTGKQRLIKRAPFSISAFSYICENEAIPMPPHWENVNTQVPYQLIPLHNQTHEYNEVANLFGKTMDRNRIKRIQRIQNLDLWEFFCRKKAQLKKKRGVPQINEQMLFHGTSSEFVEAICIHNFDWRINGIHGAVFGKGTYFARDAAYSSRFCKDDIKHGNTFQIHGVSLQQRHLFRTYKSMFLARVLIGDYINGDSKYMRPPSKDGSYVNLYDSCVDDTWNPKIFVVFDANQIYPEYLIDFH

• Full Name: poly (ADP-ribose) polymerase family, member 11
• Calculated Molecular Weight: 331 aa, 39 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC017569
• Gene Symbol: PARP11
• Gene ID (NCBI): 57097
• RRID: AB_2158504
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NR21
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PARP11, also named as ARTD11, belongs to the  ARTD/PARP family. PARP11 is a mono-ADP-ribosyltransferase that mediates mono-ADP-ribosylation of target proteins. PARP11 plays a role in nuclear envelope stability and nuclear remodeling during spermiogenesis (PMID: 25043379). PARP11 has 4 isoforms with the molecular mass of 28-40 kDa.