PARP15 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PARP15 Polyclonal antibody, PBS Only (18126-1-PBS)

• 

  WB analysis using 18126-1-AP (same clone as 18126-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 18126-1-AP (PARP15 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 18126-1-PBS in a different storage buffer formulation.

PARP15 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 18126-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

18126-1-PBS targets PARP15 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag12702

  Product name: Recombinant human PARP15 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 96-444 aa of BC101701

  Sequence: NRKSGVSRAILEGAGQAVESECAVLAAQPHRDFIITPGGCLKCKIIIHVPGGKDVRKTVTSVLEECEQRKYTSVSLPAIGTGNAGKNPITVADNIIDAIVDFSSQHSTPSLKTVKVVIFQPELLNIFYDSMKKRDLSASLNFQSTFSMTTCNLPEHWTDMNHQLFCMVQLEPGQSEYNTIKDKFTRTCSSYAIEKIERIQNAFLWQSYQVKKRQMDIKNDHKNNERLLFHGTDADSVPYVNQHGFNRSCAGKNAVSYGKGTYFAVDASYSAKDTYSKPDSNGRKHMYVVRVLTGVFTKGRAGLVTPPPKNPHNPTDLFDSVTNNTRSPKLFVVFFDNQAYPEYLITFTA

• Full Name: poly (ADP-ribose) polymerase family, member 15
• Calculated Molecular Weight: 444aa,50 kDa; 656aa,73 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: BC101701
• Gene Symbol: PARP15
• Gene ID (NCBI): 165631
• RRID: AB_2158519
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q460N3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.