PARP3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PARP3 Polyclonal antibody, PBS Only (11289-1-PBS)

• 

  WB analysis using 11289-1-AP (same clone as 11289-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 11289-1-AP (PARP3 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11289-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human kidney using 11289-1-AP (same clone as 11289-1-PBS)

  human kidney tissue were subjected to SDS PAGE followed by western blot with 11289-1-AP (PARP3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11289-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat heart using 11289-1-AP (same clone as 11289-1-PBS)

  rat heart tissue were subjected to SDS PAGE followed by western blot with 11289-1-AP (PARP3 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11289-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human heart using 11289-1-AP (same clone as 11289-1-PBS)

  human heart tissue were subjected to SDS PAGE followed by western blot with 11289-1-AP (PARP3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11289-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human pancreas cancer using 11289-1-AP (same clone as 11289-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human pancreas cancer using 11289-1-AP (PARP3 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 11289-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 11289-1-AP (same clone as 11289-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 11289-1-AP (PARP3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11289-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human renal cell carcinoma using 11289-1-AP (same clone as 11289-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human renal cell carcinoma tissue slide using 11289-1-AP (PARP3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11289-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 11289-1-AP (same clone as 11289-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 11289-1-AP (PARP3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11289-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 11289-1-AP (same clone as 11289-1-PBS)

  Immunofluorescent analysis of Hela cells, using PARP3 antibody 11289-1-AP at 1:25 dilution and Rhodamine-labeled goat anti-rabbit IgG (red). This data was developed using the same antibody clone with 11289-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

PARP3 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 11289-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

hPARP 3, EC:2.4.2.-, DNA ADP-ribosyltransferase PARP3, ARTD3, ADPRT3

---

Product Information

11289-1-PBS targets PARP3 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1844

  Product name: Recombinant human PARP3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 234-533 aa of BC014260

  Sequence: EALEEALKGPTDGGQSLEELSSHFYTVIPHNFGHSQPPPINSPELLQAKKDMLLVLADIELAQALQAVSEQEKTVEEVPHPLDRDYQLLKCQLQLLDSGAPEYKVIQTYLEQTGSNHRCPTLQHIWKVNQEGEEDRFQAHSKLGNRKLLWHGTNMAVVAAILTSGLRIMPHSGGRVGKGIYFASENSKSAGYVIGMKCGAHHVGYMFLGEVALGREHHINTDNPSLKSPPPGFDSVIARGHTEPDPTQDTELELDGQQVVVPQGQPVPCPEFSSSTFSQSEYLIYQESQCRLRYLLEVHL

• Full Name: poly (ADP-ribose) polymerase family, member 3
• Calculated Molecular Weight: 60 kDa
• Observed Molecular Weight: 60-62 kDa
• GenBank Accession Number: BC014260
• Gene Symbol: PARP3
• Gene ID (NCBI): 10039
• RRID: AB_2283392
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y6F1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PARP3 (Poly(ADP-ribose) polymerase 3), also known as ARTD3, is the third member of the PARP family that catalyze a post-translational modification of proteins to promote, control or adjust numerous cellular events including genome integrity, transcription, differentiation, cell metabolism or cell death (PMID: 31095444). PARP3 is a 60-kDa protein containing an N-terminal WGR (tryptophan-, glycine-, and arginine-rich) domain and a C-terminal catalytic domain. PARP3 has been described to interact with partners belonging to the NHEJ pathway including DNA-PKcs, DNA ligase IV, Ku70 and Ku80 and to accelerate XRCC4/DNA ligase IV-mediated ligation of chromosomal DSB in concert with APLF (PMID: 24598253).