PARP9 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PARP9 Polyclonal antibody, PBS Only (17535-1-PBS)

• 

  WB analysis using 17535-1-AP (same clone as 17535-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 17535-1-AP (PARP9 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17535-1-PBS in a different storage buffer formulation.

• 

  IP experiment of MCF-7 using 17535-1-AP (same clone as 17535-1-PBS)

  IP result of anti-PARP9 (IP:17535-1-AP, 4ug; Detection:17535-1-AP 1:3000) with MCF-7 cells lysate 1400 ug. This data was developed using the same antibody clone with 17535-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 17535-1-AP (same clone as 17535-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 17535-1-AP (PARP9 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17535-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 17535-1-AP (same clone as 17535-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 17535-1-AP (PARP9 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17535-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skin using 17535-1-AP (same clone as 17535-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skin using 17535-1-AP (PARP9 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 17535-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skin using 17535-1-AP (same clone as 17535-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skin using 17535-1-AP (PARP9 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 17535-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung using 17535-1-AP (same clone as 17535-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung using 17535-1-AP (PARP9 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 17535-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung using 17535-1-AP (same clone as 17535-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung using 17535-1-AP (PARP9 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 17535-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary using 17535-1-AP (same clone as 17535-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary using 17535-1-AP (PARP9 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 17535-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human ovary using 17535-1-AP (same clone as 17535-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human ovary using 17535-1-AP (PARP9 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 17535-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 17535-1-AP (same clone as 17535-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney using 17535-1-AP (PARP9 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 17535-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human kidney using 17535-1-AP (same clone as 17535-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human kidney using 17535-1-AP (PARP9 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 17535-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lymphoma using 17535-1-AP (same clone as 17535-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lymphoma using 17535-1-AP (PARP9 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 17535-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lymphoma using 17535-1-AP (same clone as 17535-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lymphoma using 17535-1-AP (PARP9 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 17535-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 17535-1-AP (same clone as 17535-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart using 17535-1-AP (PARP9 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 17535-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human heart using 17535-1-AP (same clone as 17535-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human heart using 17535-1-AP (PARP9 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 17535-1-PBS in a different storage buffer formulation.

• 

  IF Staining of THP-1 using 17535-1-AP (same clone as 17535-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed THP-1 cells using PARP9 antibody (17535-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 17535-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

PARP9 Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 17535-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, rat

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

ADP-ribosyltransferase diphtheria toxin-like 9, ARTD9, BAL, BAL1, EC:2.4.2.-

---

Product Information

17535-1-PBS targets PARP9 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag11587

  Product name: Recombinant human PARP9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 476-819 aa of BC039580

  Sequence: EARSPAINLMGFNVEEMYEAHAWIQRILSLQNHHIIENNHILYLGRKEHDILSQLQKTSSVSITEIISPGRTELEIEGARADLIEVVMNIEDMLCKVQEEMARKKERGLWRSLGQWTIQQQKTQDEMKENIIFLKCPVPPTQELLDQKKQFEKCGLQVLKVEKIDNEVLMAAFQRKKKMMEEKLHRQPVSHRLFQQVPYQFCNVVCRVGFQRMYSTPCDPKYGAGIYFTKNLKNLAEKAKKISAADKLIYVFEAEVLTGFFCQGHPLNIVPPPLSPGAIDGHDSVVDNVSSPETFVIFSGMQAIPQYLWTCTQEYVQSQDYSSGPMRPFAQHPWRGFASGSPVD

• Full Name: poly (ADP-ribose) polymerase family, member 9
• Calculated Molecular Weight: 819 aa, 92 kDa
• Observed Molecular Weight: 88 kDa
• GenBank Accession Number: BC039580
• Gene Symbol: PARP9
• Gene ID (NCBI): 83666
• RRID: AB_2158929
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8IXQ6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Poly(ADP-ribosyl)ation is a post-translational modification of proteins mediated by one of the 17 members of the poly(ADP-ribose) polymerases (PARP). PARP-9 belongs to the subfamily of macroPARPs, associating one to three macro domains to the PARP domain. Overexpression of PARP-9 stimulates cell migration in vitro, suggesting a role for PARP-9 in the promotion of malignant B cell migration and dissemination in high risk DLBCL. PARP-9 is also likely a transcription coactivator, its overexpression in B lymphocytes, stimulated by IFNγ, inducing the transcription of IFNγ-controlled genes.