PASK Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PASK Polyclonal antibody, PBS Only (14396-1-PBS)

• 

  WB analysis of HEK-293 using 14396-1-AP (same clone as 14396-1-PBS)

  WB result of PASK antibody (14396-1-AP; 1:300; incubated at room temperature for 1.5 hours) with sh-Control and sh-PASK transfected HEK-293 cells. This data was developed using the same antibody clone with 14396-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 14396-1-AP (same clone as 14396-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 14396-1-AP (PASK antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14396-1-PBS in a different storage buffer formulation.

• 

  WB analysis of K-562 using 14396-1-AP (same clone as 14396-1-PBS)

  K-562 cells were subjected to SDS PAGE followed by western blot with 14396-1-AP (PASK antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14396-1-PBS in a different storage buffer formulation.

• 

  IP experiment of K-562 using 14396-1-AP (same clone as 14396-1-PBS)

  IP result of anti-PASK (IP:14396-1-AP, 4ug; Detection:14396-1-AP 1:300) with K-562 cells lysate 4000 ug. This data was developed using the same antibody clone with 14396-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 14396-1-AP (same clone as 14396-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 14396-1-AP (PASK antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14396-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 14396-1-AP (same clone as 14396-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 14396-1-AP (PASK antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14396-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate hyperplasia using 14396-1-AP (same clone as 14396-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate hyperplasia tissue slide using 14396-1-AP (PASK Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 14396-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate hyperplasia using 14396-1-AP (same clone as 14396-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate hyperplasia tissue slide using 14396-1-AP (PASK Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 14396-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 14396-1-AP (same clone as 14396-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 14396-1-AP (PASK Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 14396-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 14396-1-AP (same clone as 14396-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 14396-1-AP (PASK Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 14396-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 14396-1-AP (same clone as 14396-1-PBS)

  Immunofluorescent analysis of HeLa cells using 14396-1-AP (PASK antibody) at dilution of 1:25 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 14396-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

PASK Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 14396-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

---

Product Information

14396-1-PBS targets PASK in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5893

  Product name: Recombinant human PASK protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 999-1323 aa of BC063585

  Sequence: YSTMSPLGSGAFGFVWTAVDKEKNKEVVVKFIKKEKVLEDCWIEDPKLGKVTLEIAILSRVEHANIIKVLDIFENQGFFQLVMEKHGSGLDLFAFIDRHPRLDEPLASYIFRQLVSAVGYLRLKDIIHRDIKDENIVIAEDFTIKLIDFGSAAYLERGKLFYTFCGTIEYCAPEVLMGNPYRGPELEMWSLGVTLYTLVFEENPFCELEETVEAAIHPPYLVSKELMSLVSGLLQPVPERRTTLEKLVTDPWVTQPVNLADYTWEEVFRVNKPESGVLSAASLEMGNRSLSDVAQAQELCGGPVPGEAPNGQGCLHPGDPRLLTS

• Full Name: PAS domain containing serine/threonine kinase
• Calculated Molecular Weight: 143 kDa
• Observed Molecular Weight: 180 kDa
• GenBank Accession Number: BC063585
• Gene Symbol: PASK
• Gene ID (NCBI): 23178
• RRID: AB_2878053
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96RG2
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PAS (Per-Arnt-Sim) domains regulate the function of many intracellular signaling pathways in response to both extrinsic and intrinsic stimuli. PAS domain-containing serine/threonine-protein kinase (PASK, also termed PAS-kinase or PASKIN) is an evolutionarily conserved nutrient responsive protein kinase. PASK links energy flux and protein synthesis in yeast and regulates glycogen synthesis in mammals. It has also been implicated in glucose-stimulated INS production in pancreatic beta-cells.