PAX2 Polyclonal antibody, PBS Only

• 

  WB analysis using 29307-1-AP (same clone as 29307-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 29307-1-AP (PAX2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 29307-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 29307-1-AP (same clone as 29307-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 29307-1-AP (PAX2 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29307-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 29307-1-AP (same clone as 29307-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 29307-1-AP (PAX2 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29307-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human renal cell carcinoma using 29307-1-AP (same clone as 29307-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human renal cell carcinoma tissue slide using 29307-1-AP (PAX2 antibody) at dilution of 1:2000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29307-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human renal cell carcinoma using 29307-1-AP (same clone as 29307-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human renal cell carcinoma tissue slide using 29307-1-AP (PAX2 antibody) at dilution of 1:2000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 29307-1-PBS in a different storage buffer formulation.

PAX2 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 29307-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

paired box 2, Paired box protein Pax 2, Paired box protein Pax-2, PAX 2, Pax-2

---

Product Information

29307-1-PBS targets PAX2 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30717

  Product name: Recombinant human PAX2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 189-386 aa of BC148710

  Sequence: GILGIPRSNGEKRKRDEVEVYTDPAHIRGGGGLHLVWTLRDVSEGSVPNGDSQSGVDSLRKHLRADTFTQQQLEALDRVFERPSYPDVFQASEHIKSEQGNEYSLPALTPGLDEVKSSLSASTNPELGSNVSGTQTYPVVTGRDMASTTLPGYPPHVPPTGQGSYPTSTLAGMVPGSEFSGNPYSHPQYTAYNEAWRF

• Full Name: paired box 2
• Calculated Molecular Weight: 431 aa, 46 kDa
• Observed Molecular Weight: 45 kDa
• GenBank Accession Number: BC148710
• Gene Symbol: PAX2
• Gene ID (NCBI): 5076
• RRID: AB_2918278
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q02962
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PAX2 is a transcription factor, primarily expressed during embryonic development. It has a critical role in the development of the urogenital tract, the eyes, and the CNS. It plays a key role during renal development and to act as an oncogene favoring renal tumor growth. PAX2 was suggested as a sensitive and highly specific marker for renal cell carcinoma (RCC).