PAX7 Recombinant monoclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• PAX7 Recombinant monoclonal antibody, PBS Only (83679-5-PBS)

PAX7 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 83679-5-PBS

Clone No.251683B12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

paired box 7, Paired box protein Pax-7, PAX 7, PAX-7, PAX7B

• 

  WB analysis using 83679-5-RR (same clone as 83679-5-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83679-5-RR (PAX7 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83679-5-PBS in a different storage buffer formulation.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Product Information

83679-5-PBS targets PAX7 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg4616

  Product name: Recombinant Human PAX7 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 350-450 aa of NM_002584.2

  Sequence: SAYGARHSFSSYSDSFMNPAAPSNHMNPVSNGLSPQVMSILGNPSAVPPQPQADFSISPLHGGLDSATSISASCSQRADSIKPGDSLPTSQAYCPPTYSTT

• Full Name: paired box 7
• Calculated Molecular Weight: 57kDa
• Observed Molecular Weight: 57 kDa
• GenBank Accession Number: NM_002584.2
• Gene Symbol: PAX7
• Gene ID (NCBI): 5081
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P23759-1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PAX7, also named as HUP1, belongs to the paired homeobox family. It is probable a transcription factor. PAX7 may have a role in myogenesis. A chromosomal aberration involving PAX7 is a cause of rhabdomyosarcoma 2 (RMS2) which also known as alveolar rhabdomyosarcoma.