PAX7 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• PAX7 Recombinant monoclonal antibody (83679-5-RR)

PAX7 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 83679-5-RR

Clone No.251683B12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

paired box 7, Paired box protein Pax-7, PAX 7, PAX-7, PAX7B

• 

  WB analysis using 83679-5-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 83679-5-RR (PAX7 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: TT cells, LNCaP cells, HeLa cells, NCCIT cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

83679-5-RR targets PAX7 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg4616

  Product name: Recombinant Human PAX7 protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 350-450 aa of NM_002584.2

  Sequence: SAYGARHSFSSYSDSFMNPAAPSNHMNPVSNGLSPQVMSILGNPSAVPPQPQADFSISPLHGGLDSATSISASCSQRADSIKPGDSLPTSQAYCPPTYSTT

• Full Name: paired box 7
• Calculated Molecular Weight: 57kDa
• Observed Molecular Weight: 57 kDa
• GenBank Accession Number: NM_002584.2
• Gene Symbol: PAX7
• Gene ID (NCBI): 5081
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P23759-1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PAX7, also named as HUP1, belongs to the paired homeobox family. It is probable a transcription factor. PAX7 may have a role in myogenesis. A chromosomal aberration involving PAX7 is a cause of rhabdomyosarcoma 2 (RMS2) which also known as alveolar rhabdomyosarcoma.