Product Information
87678-3-PBS targets PAX9 in WB, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag25381 Product name: Recombinant human PAX9 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 242-341 aa of BC001159 Sequence: NGLEKGALEQEAKYGQAPNGLPAVGSFVSASSMAPYPTPAQVSPYMTYSAAPSGYVAGHGWQHAGGTSLSPHNCDIPASLAFKGMQAAREGSHSVTASAL Predict reactive species |
| Full Name | paired box 9 |
| Calculated Molecular Weight | 341 aa, 36 kDa |
| Observed Molecular Weight | 38 kDa |
| GenBank Accession Number | BC001159 |
| Gene Symbol | PAX9 |
| Gene ID (NCBI) | 5083 |
| RRID | AB_3745692 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P55771 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
PAX9, a member of the paired box-containing gene family, is closely related in its paired domain to PAX1. PAX9 is essential for the development of a variety of organs and skeletal elements, particularly the initial stage of odontogenesis. Mutations in PAX9 can cause selective tooth agenesis in humans. PAX9 is reported as a sensitive marker for deregulated differentiation of oesophageal keratinocytes, and it has a role in the normal differentiation process of internal stratified squamous epithelia.



