PAX9 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• PAX9 Recombinant monoclonal antibody (87678-3-RR)

• 

  WB analysis using 87678-3-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 87678-3-RR (PAX9 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  Affinity of 87678-3-RR

  Biolayer interferometry (BLl) kinetic assays of 87678-3-RR against Human PAX9 were performed. The affinity constant is 8.47 nM.

PAX9 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 87678-3-RR

Clone No.253236E6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

paired box 9, Paired box protein Pax 9, Paired box protein Pax-9, PAX 9, PAX-9

---

Tested Applications

• Positive WB detected in: PC-3 cells, Jurkat cells, MOLT-4 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

87678-3-RR targets PAX9 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag25381

  Product name: Recombinant human PAX9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 242-341 aa of BC001159

  Sequence: NGLEKGALEQEAKYGQAPNGLPAVGSFVSASSMAPYPTPAQVSPYMTYSAAPSGYVAGHGWQHAGGTSLSPHNCDIPASLAFKGMQAAREGSHSVTASAL

• Full Name: paired box 9
• Calculated Molecular Weight: 341 aa, 36 kDa
• Observed Molecular Weight: 38 kDa
• GenBank Accession Number: BC001159
• Gene Symbol: PAX9
• Gene ID (NCBI): 5083
• RRID: AB_3745692
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P55771
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PAX9, a member of the paired box-containing gene family, is closely related in its paired domain to PAX1. PAX9 is essential for the development of a variety of organs and skeletal elements, particularly the initial stage of odontogenesis. Mutations in PAX9 can cause selective tooth agenesis in humans. PAX9 is reported as a sensitive marker for deregulated differentiation of oesophageal keratinocytes, and it has a role in the normal differentiation process of internal stratified squamous epithelia.