PCBD1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PCBD1 Polyclonal antibody, PBS Only (15702-1-PBS)

• 

  WB analysis using 15702-1-AP (same clone as 15702-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 15702-1-AP (PCBD1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15702-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 15702-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 15702-1-AP (PCBD1 antibody) at dilution of 1:100 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 15702-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 15702-1-AP (PCBD1 antibody) at dilution of 1:100 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 15702-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 15702-1-AP (PCBD1 antibody) at dilution of 1:100 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 15702-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 15702-1-AP (PCBD1 antibody) at dilution of 1:100 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse liver using 15702-1-AP (same clone as 15702-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 15702-1-AP (PCBD1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15702-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 15702-1-AP (same clone as 15702-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 15702-1-AP (PCBD1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15702-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 15702-1-AP (same clone as 15702-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 15702-1-AP (PCBD1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15702-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse kidney using 15702-1-AP (same clone as 15702-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 15702-1-AP (PCBD1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15702-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse liver using 15702-1-AP (same clone as 15702-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse liver tissue slide using 15702-1-AP (PCBD1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15702-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 15702-1-AP (same clone as 15702-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using PCBD1 antibody (15702-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-phalloidin (red). This data was developed using the same antibody clone with 15702-1-PBS in a different storage buffer formulation.

PCBD1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 15702-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

4-alpha-hydroxy-tetrahydropterin dehydratase, DCOH, Dimerization cofactor of hepatocyte nuclear factor 1-alpha, EC:4.2.1.96, PCBD

---

Product Information

15702-1-PBS targets PCBD1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag8331

  Product name: Recombinant human PCBD1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-104 aa of BC006324

  Sequence: MAGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT

• Full Name: pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha
• Calculated Molecular Weight: 104 aa, 12 kDa
• Observed Molecular Weight: 12 kDa
• GenBank Accession Number: BC006324
• Gene Symbol: PCBD1
• Gene ID (NCBI): 5092
• RRID: AB_2267945
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P61457
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PCBD1, also known as DCOH and PCBD, belongs to the pterin-4-alpha-carbinolamine dehydratase family. PCBD1 is a bifunctional protein that acts as an enzyme in the regeneration of cofactor tetrahydrobiopterin (BH4), crucial for the function of aromatic amino acid hydroxylases, and as a dimerization cofactor of transcription factors HNF1A and HNF1B, important in liver and pancreas development and function. PCBD1 is expressed in the developing pancreas. The calculated molecular weight of PCBD1 is 12 kDa (PMID: 24204001, 24848070).