PCBD2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PCBD2 Polyclonal antibody, PBS Only (11958-1-PBS)

• 

  WB analysis of human skeletal muscle using 11958-1-AP (same clone as 11958-1-PBS)

  human skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 11958-1-AP (PCBD2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11958-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human skeletal muscle using 11958-1-AP (same clone as 11958-1-PBS)

  human skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 11958-1-AP (PCBD2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11958-1-PBS in a different storage buffer formulation.

PCBD2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 11958-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

11958-1-PBS targets PCBD2 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2562

  Product name: Recombinant human PCBD2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-130 aa of BC054021

  Sequence: MAAVLGALGATRRLLAALRGQSLGLAAMSSGTHRLTAEERNQAILDLKAAGWSELSERDAIYKEFSFHNFNQAFGFMSRVALQAEKMNHHPEWFNVYNKVQITLTSHDCGELTKKDVKLAKFIEKAAASV

• Full Name: pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1) 2
• Calculated Molecular Weight: 130 aa, 14 kDa
• Observed Molecular Weight: 14 kDa
• GenBank Accession Number: BC054021
• Gene Symbol: PCBD2
• Gene ID (NCBI): 84105
• RRID: AB_2877806
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H0N5
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PCBD2(Pterin-4-alpha-carbinolamine dehydratase 2) is also named DCOH2, DCOHM and belongs to the pterin-4-alpha-carbinolamine dehydratase family. It is involved in tetrahydrobiopterin biosynthesis and it seems to both prevent the formation of 7-pterins and accelerate the formation of quinonoid-BH2. PCBD2 also regulates the dimerization of homeodomain protein HNF-1-alpha and enhances its transcriptional activity.