Use Able AI chat for product recommendations

APC-conjugated PCDH9 Polyclonal antibody

PCDH9 Polyclonal Antibody for

Cat No. APC-25090

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

Protocadherin-9

Formulation:  PBS, Azide, BSA
PBS, Azide, BSA
Conjugate:  APC
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

APC-25090 targets PCDH9 in applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag18696

Product name: Recombinant human PCDH9 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1146-1237 aa of BC136626

Sequence: PGLGPYQHPKSPLSTFAPQKEWVKKDKLVNGHTLTRAWKEDSNRNQFNDRKQYGSNEGHFNNGSHMTDIPLANLKSYKQAGGATESPKEHQL

Predict reactive species
Full Name protocadherin 9
Calculated Molecular Weight 1237 aa, 136 kDa
Observed Molecular Weight 150-180 kDa
GenBank Accession NumberBC136626
Gene Symbol PCDH9
Gene ID (NCBI) 5101
Conjugate APC Fluorescent Dye
Excitation/Emission Maxima Wavelengths650 nm / 660 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9HC56
Storage Buffer PBS with 0.09% sodium azide and 0.5% BSA, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

Protocadherin-9 (PCDH9) is a member of the protocadherin family that belongs to the cadherin superfamily. Protocadherins are calcium-dependent adhesion proteins and have been implicated in neural cell-cell interactions. They are abundantly expressed in the central nervous system during embryonic development and in adulthood (PMID: 24214103). PCDH9 is a single-pass type I membrane protein that contains seven cadherin motifs in its extracellular domain. It might be involved in the formation of specific neural circuits during neural development (PMID: 22982106).

What is the molecular weight of PCDH9?

The calculated molecular weight of PCDH9 is 136 kDa.

What are the isoforms of PCDH9?

Alternatively spliced transcript variants encoding distinct isoforms have been identified for the PCDH9 gene; a short transcript, a standard transcript, a transcript with additional exon 2, and another transcript with variant exon 3 (PMID: 15095963).

What is PCDH9's involvement in neural development?

The family of protocadherins is essential for neural development as mutations in these proteins give rise to neurodevelopmental disorders such as schizophrenia and epilepsy. However, the exact mechanisms of loss of function and the role of PCDH9 remain to be fully characterized (PMID: 22982106).


Loading...
||
New chat

Able

正在加载,请稍候...