PCDHA6 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PCDHA6 Polyclonal antibody, PBS Only (12853-1-PBS)

• 

  WB analysis of rat brain using 12853-1-AP (same clone as 12853-1-PBS)

  rat brain tissue were subjected to SDS PAGE followed by western blot with 12853-1-AP (PCDHA6 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12853-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 12853-1-AP (same clone as 12853-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 12853-1-AP (PCDHA6 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12853-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human brain using 12853-1-AP (same clone as 12853-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 12853-1-AP (PCDHA6 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12853-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 12853-1-AP (same clone as 12853-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 12853-1-AP (PCDHA6 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12853-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human gliomas using 12853-1-AP (same clone as 12853-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 12853-1-AP (PCDHA6 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12853-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human gliomas using 12853-1-AP (same clone as 12853-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 12853-1-AP (PCDHA6 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12853-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat cerebellum using 12853-1-AP (same clone as 12853-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat cerebellum tissue slide using 12853-1-AP (PCDHA6 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12853-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat cerebellum using 12853-1-AP (same clone as 12853-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat cerebellum tissue slide using 12853-1-AP (PCDHA6 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12853-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 12853-1-AP (same clone as 12853-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 12853-1-AP (PCDHA6 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12853-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 12853-1-AP (same clone as 12853-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 12853-1-AP (PCDHA6 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12853-1-PBS in a different storage buffer formulation.

PCDHA6 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 12853-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

12853-1-PBS targets PCDHA6 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3493

  Product name: Recombinant human PCDHA6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 711-950 aa of BC036674

  Sequence: LVLTLLLYTALRCSAPPTEGACTADKPTLVCSSAVGSWSYSQQRRQRVCSGEGPPKMDLMAFSPSLSPCPIMMGKAENQDLNEDHDAKPRQPNPDWRYSASLRAGMHSSVHLEEAGILRAGPGGPDQQWPTVSSATPEPEAGEVSPPVGAGVNSNSWTFKYGPGNPKQSGPGELPDKFIIPGSPAIISIRQEPTNSQIDKSDFITFGKKEETKKKKKKKKGNKTQEKKEKGNSTTDNSDQ

• Full Name: protocadherin alpha 6
• Calculated Molecular Weight: 103 kDa
• Observed Molecular Weight: 120 kDa
• GenBank Accession Number: BC036674
• Gene Symbol: PCDHA6
• Gene ID (NCBI): 56142
• RRID: AB_10642141
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UN73
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.