CoraLite® Plus 488-conjugated PCF11 Recombinant monoclonal antibody

PCF11 Recombinant Antibody for IF/ICC, FC (Intra)
Cat No. CL488-84081-5
Clone No.241213B12

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC, FC (Intra)

Pre-mRNA cleavage complex II protein Pcf11, Pre-mRNA cleavage complex 2 protein Pcf11, KIAA0824, 241213B12

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inU2OS cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-84081-5 targets PCF11 in IF/ICC, FC (Intra) applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag20263

Product name: Recombinant human PCF11 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1206-1555 aa of BC146778

Sequence: IPAPMTVGNIQASQQVLSGVAQPVAFGQGQQFLPVHPQNPGFVQNPSGALPKAYPDNHLSQVDVNELFSKLLKTGILKLSQTDSATTQVSEVTAQPPPEEEEDQNEDQDVPDLTNFTVEELKQRYDSVINRLYTGIQCYSCGMRFTTSQTDVYADHLDWHYRQNRTEKDVSRKVTHRRWYYSLTDWIEFEEIADLEERAKSQFFEKVHEEVVLKTQEAAKEKEFQSVPAGPAGAVESCEICQEQFEQYWDEEEEEWHLKNAIRVDGKIYHPSCYEDYQNTSSFDCTPSPSKTPVENPLNIMLNIVKNELQEPCDSPKVKEERIDTPPACTEESIATPSEIKTENDTVESV

Predict reactive species
Full Name PCF11, cleavage and polyadenylation factor subunit, homolog (S. cerevisiae)
Calculated Molecular Weight 1555 aa, 173 kDa
GenBank Accession NumberBC146778
Gene Symbol PCF11
Gene ID (NCBI) 51585
RRIDAB_3673339
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO94913
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

In Saccharomyces cerevisiae, the cleavage/polyadenylation factor Pcf11 is a crucial regulatory factor required for recruiting polyadenylation machinery to elongating RNA polymerase II (RNAPII), and is necessary for correct transcriptional termination. Pcf11 (PCF11, cleavage and polyadenylation factor subunit, homolog (S. cerevisiae)), is a 1,555 amino acid nuclear protein that is a component of pre-mRNA cleavage complex II. It is suggested that Pcf11 is capable of promoting the dissociation of Pol II elongation complexes from DNA. Pcf11 contains a CTD-interaction domain that binds in a phospho-dependent manner to the heptad repeats within the RNA polymerase II CTD. The gene encoding Pcf11 is located on human chromosoem 11, which houses over 1,400 genes and comprises nearly 4% of the human genome. Jervell and Lange-Nielsen syndrome, Jacobsen syndrome, Niemann-Pick disease, hereditary angioedema and Smith-Lemli-Opitz syndrome are associated with defects in genes that maps to chromosome 11.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 PCF11 antibody CL488-84081-5Download protocol
IF protocol for CL Plus 488 PCF11 antibody CL488-84081-5Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...