PCMTD2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PCMTD2 Polyclonal antibody, PBS Only (21114-1-PBS)

• 

  WB analysis using 21114-1-AP (same clone as 21114-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 21114-1-AP (PCMTD2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21114-1-PBS in a different storage buffer formulation.

PCMTD2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 21114-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

C20orf36, KIAA0835, KIAA1050

---

Product Information

21114-1-PBS targets PCMTD2 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15347

  Product name: Recombinant human PCMTD2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 248-361 aa of BC033665

  Sequence: RIAIRGTIKKIIHQETVSKNGNGLKNTPRFKRRRVRRRRMETIVFLDKEVFASRISNPSDDNSCEDLEEERREEEEKTPPETKPDPPVNFLRQKVLSLPLPDPLKYYLLYYREK

• Full Name: protein-L-isoaspartate (D-aspartate) O-methyltransferase domain containing 2
• Calculated Molecular Weight: 361 aa, 41 kDa
• Observed Molecular Weight: 38-41 kDa
• GenBank Accession Number: BC033665
• Gene Symbol: PCMTD2
• Gene ID (NCBI): 55251
• RRID: AB_3742016
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NV79
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PCMTD2 (Protein-L-isoaspartate O-methyltransferase domain-containing protein 2) has also been linked to various disease states including neurodevelopmental disorders and cancer. CUL5 E3 ligase complex can target CD247 and IL2RB through its adaptor protein PCMTD2. PCMTD2 is expressed in pigmented layer of retina.