PCNX1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PCNX1 Polyclonal antibody, PBS Only (32431-1-PBS)

• 

  WB analysis using 32431-1-AP (same clone as 32431-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 32431-1-AP (PCNX1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 32431-1-PBS in a different storage buffer formulation.

PCNX1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 32431-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

Pecanex-like protein 1, Pecanex homolog protein 1, PCNXL1, PCNX, KIAA0995

---

Product Information

32431-1-PBS targets PCNX1 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag37954

  Product name: Recombinant human PCNX protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 2035-2230 aa of BC140784

  Sequence: VPCRRSSTSQISLRNLPSSIQSRLSMVNQMEPSGQSGLACVQHGLPSSSSSSQSIPACKHHTLVGFLATEGGQSSATDAQPGNTLSPANNSHSRKAEVIYRVQIVDPSQILEGINLSKRKELQWPDEGIRLKAGRNSWKDWSPQEGMEGHVIHRWVPCSRDPGTRSHIDKAVLLVQIDDKYVTVIETGVLELGAEV

• Full Name: pecanex homolog (Drosophila)
• Calculated Molecular Weight: 259 kDa
• Observed Molecular Weight: 240 kDa
• GenBank Accession Number: BC140784
• Gene Symbol: PCNX
• Gene ID (NCBI): 22990
• RRID: AB_3742608
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q96RV3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.