PCOLCE Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PCOLCE Polyclonal antibody, PBS Only (14993-1-PBS)

• 

  WB analysis using 14993-1-AP (same clone as 14993-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 14993-1-AP (PCOLCE antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14993-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse ovary using 14993-1-AP (same clone as 14993-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse ovary tissue slide using 14993-1-AP (PCOLCE antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14993-1-PBS in a different storage buffer formulation.

PCOLCE Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 14993-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, Indirect ELISA

Synonyms

PCPE, PCPE 1, PCPE1, PCPE-1, Procollagen C-endopeptidase enhancer 1

---

Product Information

14993-1-PBS targets PCOLCE in WB, IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6979

  Product name: Recombinant human PCOLCE protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 169-449 aa of BC000574

  Sequence: TLTTPNWPESDYPPGISCSWHIIAPPDQVIALTFEKFDLEPDTYCRYDSVSVFNGAVSDDSRRLGKFCGDAVPGSISSEGNELLVQFVSDLSVTADGFSASYKTLPRGTAKEGQGPGPKRGTEPKVKLPPKSQPPEKTEESPSAPDAPTCPKQCRRTGTLQSNFCASSLVVTATVKSMVREPGEGLAVTVSLIGAYKTGGLDLPSPPTGASLKFYVPCKQCPPMKKGVSYLLMGQVEENRGPVLPPESFVVLHRPNQDQILTNLSKRKCPSQPVRAAASQD

• Full Name: procollagen C-endopeptidase enhancer
• Calculated Molecular Weight: 48 kDa
• Observed Molecular Weight: 48-50 kDa
• GenBank Accession Number: BC000574
• Gene Symbol: PCOLCE
• Gene ID (NCBI): 5118
• RRID: AB_2158418
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15113
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PCOLCE (Procollagen C-endopeptidase enhancer 1), also named as PCPE1, is a secreted glycoprotein that functions as a positive regulator of procollagen processing. PCOLCE binds to the C-terminal propeptide of type I procollagen and enhances procollagen C-proteinase activity. Procollagen C-proteinases have important roles in developmental processes and assembly of the extracellular matrix.