PCSK9 Polyclonal antibody

• 

  WB analysis using 27882-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27882-1-AP (PCSK9 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 27882-1-AP

  WB result of PCSK9 antibody (27882-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-PCSK9 transfected HepG2 cells.

• 

  FC experiment of HepG2 using 27882-1-AP

  1X10^6 HepG2 cells were intracellularly stained with 0.4 ug Anti-Human PCSK9 (27882-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• Featured Product
• KD/KO Validated

PCSK9 Polyclonal Antibody for WB, FC (Intra), ELISA

Cat No. 27882-1-AP

Publications(11)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, FC (Intra), ELISA

Synonyms

EC:3.4.21.-, FH3, HCHOLA3, LDLCQ1, NARC 1

---

Tested Applications

• Positive WB detected in: HepG2 cells, rat liver tissue, mouse liver tissue
• Positive FC (Intra) detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 9 publications below
• IHC: See 4 publications below
• IF: See 3 publications below

Product Information

27882-1-AP targets PCSK9 in WB, IHC, IF, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag27254

  Product name: Recombinant human PCSK9 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 476-692 aa of NM_174936.3

  Sequence: MRCAPDEELLSCSSFSRSGKRRGERMEAQGGKLVCRAHNAFGGEGVYAIARCCLLPQANCSVHTAPPAEASMGTRVHCHQQGHVLTGCSSHWEVEDLGTHKPPVLRPRGQPNQCVGHREASIHASCCHAPGLECKVKEHGIPAPQEQVTVACEEGWTLTGCSALPGTSHVLGAYAVDNTCVVRSRDVSTTGSTSEGAVTAVAICCRSRHLAQASQELQ

• Full Name: proprotein convertase subtilisin/kexin type 9
• Calculated Molecular Weight: 74 kDa
• Observed Molecular Weight: 72-78 kDa, 62 kDa
• GenBank Accession Number: NM_174936.3
• Gene Symbol: PCSK9
• Gene ID (NCBI): 255738
• RRID: AB_2918134
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8NBP7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Proprotein convertase subtilisin/kexin type 9 (PCSK9) is a crucial protein governing the circulating levels of low density lipoprotein-cholesterol (LDL-C), by virtue of its pivotal role in the degradation of the LDL receptor (LDLR). PCSK9 is expressed in the kidney and lung. It is synthesized as a 72 kDa immature precursor that undergoes autocatalytic cleavage in the endoplasmic reticulum to generate a 63 kDa mature protein. The cleaved N-terminal fragment remains associated with the mature protein and is necessary for its secretion, allowing it to circulate in the blood. The ability of PCSK9 to regulate a diverse group of cell-surface proteins hinted that it might also be able to influence additional membrane proteins that are important in anti-tumour immune responses. Targeting PCSK9 to treat cancer is also attractive because two neutralizing antibodies against it, evolocumab and alirocumab, have already been approved for human clinical use to lower cholesterol levels. (PMID: 30522786, PMID: 22493497)

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IF	Phytomedicine; LW-213, a derivative of wogonin, triggers reticulophagy-mediated cell death in NSCLC via lysosomal damage combined with NPC1 inhibition; Authors - Hongzheng Wang
rat	IHC	Biochimie; High-salt diet induces dyslipidemia through the SREBP2/PCSK9 pathway in dahl salt-sensitive rats; Authors - Ya-Nan Ou-Yang
mouse	WB	bioRxiv; Effect of Total Sphingomyelin Synthase Activity on Low Density Lipoprotein Catabolism in Mice; Authors - Zhiqiang Li
rat	WB	Int J Mol Sci; Protective Effects of Dioscin and Diosgenin on Plateau Hyperuricemia by Attenuating Renal Inflammation via EPHX2; Authors - Wanyun Dang
mouse	WB	Biochim Biophys Acta Mol Cell Res; Proprotein convertase subtilisin/kexin type 9 contributes to cisplatin-induced acute kidney injury by interacting with cyclase-associated protein 1 to promote megalin lysosomal degradation; Authors - Zihan Wang
mouse,human	WB,IHC,IF	iScience; Targeting PCSK9 reduces cancer cell stemness and enhances antitumor immunity in head and neck cancer; Authors - Qi-Chao Yang ; KD Validated