PCTAIRE1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PCTAIRE1 Polyclonal antibody (10102-1-AP)

• Featured Product
• KD/KO Validated

PCTAIRE1 Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 10102-1-AP

Publications(6)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF, IP, ELISA

Synonyms

CDK16, PCTAIRE, PCTAIRE motif protein kinase 1, PCTAIRE protein kinase 1, PCTAIRE1, PCTGAIRE, PCTK1

• 

  WB analysis of mouse brain using 10102-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 10102-1-AP (PCTAIRE1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 10102-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 10102-1-AP (PCTAIRE1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse brain using 10102-1-AP

  IP result of anti-PCTAIRE1 (IP:10102-1-AP, 4ug; Detection:10102-1-AP 1:500) with mouse brain tissue lysate 4400ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas using 10102-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas tissue slide using 10102-1-AP (PCTAIRE1 antibody at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas using 10102-1-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas tissue slide using 10102-1-AP (PCTAIRE1 antibody at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: mouse brain tissue
• Positive IP detected in: mouse brain tissue
• Positive IHC detected in: human pancreas tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10102-1-AP targets PCTAIRE1 in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0151

  Product name: Recombinant human PCTK1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-307 aa of BC001048

  Sequence: MDRMKKIKRQLSMTLRGGRGIDKTNGAPEQIGLDESGGGGGSDPGEAPTRAAPGELRSARGPLSSAPEIVHEDLKMGSDGESDQASATSSDEVQSPVRVRMRNHPPRKISTEDINKRLSLPADIRLPEGYLEKLTLNSPIFDKPLSRRLRRVSLSEIGFGKLETYIKLDKLGEGTYATVYKGKSKLTDNLVALKEIRLEHEEGAPCTAIREVSLLKDLKHANIVTLHDIIHTEKSLTLVFEYLDKDLKQYLDDCGNIINMHNVKLFLFQLLRGLAYCHRQKVLHRDLKPQNLLINERGELKLADFGL

• Full Name: PCTAIRE protein kinase 1
• Calculated Molecular Weight: 56 kDa
• Observed Molecular Weight: 56-63 kDa
• GenBank Accession Number: BC001048
• Gene Symbol: PCTAIRE1
• Gene ID (NCBI): 5127
• RRID: AB_513483
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q00536
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC	Theranostics; CDK16 Phosphorylates and Degrades p53 to Promote Radioresistance and Predicts Prognosis in Lung Cancer.; Authors - Jie Xie
mouse	WB	Elife; Loss of Tsc1 in cerebellar Purkinje cells induces transcriptional and translation changes in FMRP target transcripts; Authors - Jasbir Singh Dalal
human	WB	Mol Oncol; Lung cancer cells expressing a shortened CDK16 3'UTR escape senescence through impaired miR-485-5p targeting.; Authors - Qi Jia ; KD Validated
human	WB	Tumour Biol; Functional elucidation of miR-494 in the tumorigenesis of nasopharyngeal carcinoma.; Authors - Hong-Fang Duan
human	WB	Small Methods; CDK16+ Luminal Progenitor Cell-Like Tumor Cells Interacted with POSTN+ Cancer-Associated Fibroblasts Associate with Chemo-Resistance In Breast Cancer; Authors - Xinyu Ding
	IF	Mol Cell Proteomics; Proteomic characterization of the Alzheimer's disease risk factor BIN1 interactome; Authors - Joseph D McMillan