PCYT1A Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PCYT1A Polyclonal antibody, PBS Only (30991-1-PBS)

• 

  WB analysis using 30991-1-AP (same clone as 30991-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30991-1-AP (PCYT1A antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30991-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 30991-1-AP (same clone as 30991-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30991-1-AP (PCYT1A antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30991-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 30991-1-AP (same clone as 30991-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using PCYT1A antibody (30991-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 30991-1-PBS in a different storage buffer formulation.

• 

  IF Staining of U-251 using 30991-1-AP (same clone as 30991-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed U-251 cells using PCYT1A antibody (30991-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red). This data was developed using the same antibody clone with 30991-1-PBS in a different storage buffer formulation.

PCYT1A Polyclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 30991-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

CCT A, CCT alpha, CT A, CTPCT, PCYT1

---

Product Information

30991-1-PBS targets PCYT1A in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34268

  Product name: Recombinant human PCYT1A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-76 aa of NM_005017

  Sequence: MDAQCSAKVNARKRRKEAPGPNGATEEDGVPSKVQRCAVGLRQPAPFSDEIEVDFSKPYVRVTMEEASRGTPCERP

• Full Name: phosphate cytidylyltransferase 1, choline, alpha
• Calculated Molecular Weight: 42 kDa
• Observed Molecular Weight: 40-41 kDa
• GenBank Accession Number: NM_005017
• Gene Symbol: PCYT1A
• Gene ID (NCBI): 5130
• RRID: AB_3742383
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: P49585
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PCYT1A (phosphate cytidylyltransferase 1A, choline), also known as CTPCT. It is expected to be located in the nucleus and cytoplasm, which is enriched in brain, placenta, liver, fetal and adult lung. This gene belongs to the cytidylyltransferase family and is involved in the regulation of phosphatidylcholine biosynthesis. Mutations in this gene are associated with spondylometaphyseal dysplasia with cone-rod dystrophy. The molecular weight of PCYT1A is 41 kDa.