PCYT1A Recombinant monoclonal antibody

• 

  WB analysis using 83100-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 83100-1-RR (PCYT1A antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 83100-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 83100-1-RR (PCYT1A antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of MCF-7 using 83100-1-RR

  Immunofluorescent analysis of (4% PFA) fixed MCF-7 cells using PCYT1A antibody (83100-1-RR, Clone: 230393B4 ) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-phalloidin (red).

• 

  FC experiment of A431 using 83100-1-RR

  1x10^6 A431 cells were intracellularly stained with 0.25 ug Anti-Human PCYT1A (83100-1-RR, Clone:230393B4) and APC-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L)(red), or 0.25 ug rabbit IgG isotype control (blue). Cells were fixed and permeabilized with True-Nuclear Transcription Factor Buffer Set.

• 

  Affinity and Kinetic Characterization of 83100-1-RR

  Biolayer interferometry (BLl) kinetic assays of 83100-1-RR against Human PCYT1A were performed. The affinity constant is below 1 pM.

PCYT1A Uni-rAb^® Recombinant Antibody for WB, IF/ICC, FC (Intra), ELISA

Cat No. 83100-1-RR

Clone No.230393B4

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, FC (Intra), ELISA

Synonyms

230393B4, CCT A, CCT alpha, CT A, CTPCT

---

Tested Applications

• Positive WB detected in: HEK-293 cells, NIH/3T3 cells, mouse testis tissue, mouse brain tissue
• Positive IF/ICC detected in: MCF-7 cells
• Positive FC (Intra) detected in: A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

83100-1-RR targets PCYT1A in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag34268

  Product name: Recombinant human PCYT1A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-76 aa of NM_005017

  Sequence: MDAQCSAKVNARKRRKEAPGPNGATEEDGVPSKVQRCAVGLRQPAPFSDEIEVDFSKPYVRVTMEEASRGTPCERP

• Full Name: phosphate cytidylyltransferase 1, choline, alpha
• Calculated Molecular Weight: 42 kDa
• Observed Molecular Weight: 38-41 kDa
• GenBank Accession Number: NM_005017
• Gene Symbol: PCYT1A
• Gene ID (NCBI): 5130
• RRID: AB_3670813
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P49585
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Hua (Verified Customer) (08-30-2024)

Great antibody. Very strong signal and clean background.

• Applications: Western Blot
• Primary Antibody Dilution: 1:10,000
• Cell Tissue Type: Mouse liver

PCYT1A Antibody Western Blot validation (1:10,000 dilution) in Mouse liver (Cat no:83100-1-RR)