PCYT2 Monoclonal antibody

• 

  WB analysis using 68355-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 68355-1-Ig (PCYT2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control.

• 

  IF Staining of HepG2 using 68355-1-Ig

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using PCYT2 antibody (68355-1-Ig, Clone: 2F7G1 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L).

PCYT2 Monoclonal Antibody for WB, IF/ICC, ELISA

Cat No. 68355-1-Ig

Clone No.2F7G1

Host / Isotype

Mouse / IgG2a

Reactivity

Human

Applications

WB, IF/ICC, ELISA

Synonyms

ET, PCYT2

---

Tested Applications

• Positive WB detected in: LNCaP cells, HeLa cells, HepG2 cells, HEK-293 cells, Jurkat cells, K-562 cells
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:400-1:1600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

68355-1-Ig targets PCYT2 in WB, IF/ICC, ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6604

  Product name: Recombinant human PCYT2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-389 aa of BC000351

  Sequence: MIRNGRGAAGGAEQPGPGGRRAVRVWCDGCYDMVHYGHSNQLRQARAMGDYLIVGVHTDEEIAKHKGPPVFTQEERYKMVQAIKWVDEVVPAAPYVTTLETLDKYNCDFCVHGNDITLTVDGRDTYEEVKQAGRYRECKRTQGVSTTDLVGRMLLVTKAHHSSQEMSSEYREYADSFGKCPGGRNPWTGVSQFLQTSQKIIQFASGKEPQPGETVIYVAGAFDLFHIGHVDFLEKVHRLAERPYIIAGLHFDQEVNHYKGKNYPIMNLHERTLSVLACRYVSEVVIGAPYAVTAELLSHFKVDLVCHGKTEIIPDRDGSDPYQEPKRRGIFRQIDSGSNLTTDLIVQRIITNRLEYEARNQKKEAKELAFLEAARQQAAQPLGERDGDF

• Full Name: phosphate cytidylyltransferase 2, ethanolamine
• Calculated Molecular Weight: 44 kDa
• Observed Molecular Weight: 44 kDa
• GenBank Accession Number: BC000351
• Gene Symbol: PCYT2
• Gene ID (NCBI): 5833
• RRID: AB_3085077
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q99447
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Ethanolamine-phosphate cytidylyltransferase (PCYT2) catalyzes the second step in the synthesis of phosphatidylethanolamine (PE) from ethanolamine via the CDP-ethanolamine pathway (PMID:9083101, PMID:31637422). Phosphatidylethanolamine is a dominant inner-leaflet phospholipid in cell membranes, where it plays a role in membrane function by structurally stabilizing membrane-anchored proteins, and participates in important cellular processes such as cell division, cell fusion, blood coagulation, and apoptosis (PMID:9083101).