PCYT2 Monoclonal antibody, PBS Only

• 

  WB analysis using 68355-1-Ig (same clone as 68355-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68355-1-Ig (PCYT2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 68355-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 68355-1-Ig (same clone as 68355-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using PCYT2 antibody (68355-1-Ig, Clone: 2F7G1 ) at dilution of 1:800 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 68355-1-PBS in a different storage buffer formulation.

PCYT2 Monoclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 68355-1-PBS

Clone No.2F7G1

Host / Isotype

Mouse / IgG2a

Reactivity

Human

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

ET, PCYT2

---

Product Information

68355-1-PBS targets PCYT2 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG2a
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6604

  Product name: Recombinant human PCYT2 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-389 aa of BC000351

  Sequence: MIRNGRGAAGGAEQPGPGGRRAVRVWCDGCYDMVHYGHSNQLRQARAMGDYLIVGVHTDEEIAKHKGPPVFTQEERYKMVQAIKWVDEVVPAAPYVTTLETLDKYNCDFCVHGNDITLTVDGRDTYEEVKQAGRYRECKRTQGVSTTDLVGRMLLVTKAHHSSQEMSSEYREYADSFGKCPGGRNPWTGVSQFLQTSQKIIQFASGKEPQPGETVIYVAGAFDLFHIGHVDFLEKVHRLAERPYIIAGLHFDQEVNHYKGKNYPIMNLHERTLSVLACRYVSEVVIGAPYAVTAELLSHFKVDLVCHGKTEIIPDRDGSDPYQEPKRRGIFRQIDSGSNLTTDLIVQRIITNRLEYEARNQKKEAKELAFLEAARQQAAQPLGERDGDF

• Full Name: phosphate cytidylyltransferase 2, ethanolamine
• Calculated Molecular Weight: 44 kDa
• Observed Molecular Weight: 44 kDa
• GenBank Accession Number: BC000351
• Gene Symbol: PCYT2
• Gene ID (NCBI): 5833
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q99447
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Ethanolamine-phosphate cytidylyltransferase (PCYT2) catalyzes the second step in the synthesis of phosphatidylethanolamine (PE) from ethanolamine via the CDP-ethanolamine pathway (PMID:9083101, PMID:31637422). Phosphatidylethanolamine is a dominant inner-leaflet phospholipid in cell membranes, where it plays a role in membrane function by structurally stabilizing membrane-anchored proteins, and participates in important cellular processes such as cell division, cell fusion, blood coagulation, and apoptosis (PMID:9083101).