Mouse PD-1/CD279 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 83516-6-RR (same clone as 83516-6-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 83516-6-RR (PD-1/CD279 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83516-6-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83516-6-RR

  Biolayer interferometry (BLl) kinetic assays of 83516-6-RR against Mouse PD-1/CD279 were performed. The affinity constant is below 1 pM.

PD-1/CD279 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 83516-6-PBS

Clone No.240390D6

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, ELISA

Synonyms

CD279, PD1, PD-1, 240390D6, PD 1

---

Product Information

83516-6-PBS targets PD-1/CD279 in WB, ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg0918

  Product name: Recombinant mouse PD-1 protein

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 25-167 aa of NM_008798.2

  Sequence: LEVPNGPWRSLTFYPAWLTVSEGANATFTCSLSNWSEDLMLNWNRLSPSNQTEKQAAFCNGLSQPVQDARFQIIQLPNRHDFHMNILDTRRNDSGIYLCGAISLHPKAKIEESPGAELVVTERILETSTRYPSPSPKPEGRFQ

• Full Name: programmed cell death 1
• Calculated Molecular Weight: 32 kDa
• GenBank Accession Number: NM_008798.2
• Gene Symbol: PD-1
• Gene ID (NCBI): 18566
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q02242
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.