PD-1/CD279 Recombinant monoclonal antibody

PD-1/CD279 Uni-rAb® Recombinant Antibody for WB, ELISA
Cat No. 83516-6-RR
Clone No.240390D6

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, ELISA

CD279, PD1, PD-1, 240390D6, PD 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inEL-4 cells, RAW 264.7 cells, mouse thymus tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:16000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

83516-6-RR targets PD-1/CD279 in WB, ELISA applications and shows reactivity with mouse samples.

Tested Reactivity mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg0918

Product name: Recombinant mouse PD-1 protein

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-6*HIS

Domain: 25-167 aa of NM_008798.2

Sequence: LEVPNGPWRSLTFYPAWLTVSEGANATFTCSLSNWSEDLMLNWNRLSPSNQTEKQAAFCNGLSQPVQDARFQIIQLPNRHDFHMNILDTRRNDSGIYLCGAISLHPKAKIEESPGAELVVTERILETSTRYPSPSPKPEGRFQ

Predict reactive species
Full Name programmed cell death 1
Calculated Molecular Weight32 kDa
Observed Molecular Weight55 kDa
GenBank Accession NumberNM_008798.2
Gene Symbol PD-1
Gene ID (NCBI) 18566
RRIDAB_3671141
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDQ02242
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Programmed cell death 1 (PD-1, also known as CD279) is an immunoinhibitory receptor that belongs to the CD28/CTLA-4 subfamily of the Ig superfamily. It is a 288 amino acid (aa) type I transmembrane protein composed of one Ig superfamily domain, a stalk, a transmembrane domain, and an intracellular domain containing an immunoreceptor tyrosine-based inhibitory motif (ITIM) as well as an immunoreceptor tyrosine-based switch motif (ITSM) (PMID: 18173375). PD-1 is expressed during thymic development and is induced in a variety of hematopoietic cells in the periphery by antigen receptor signaling and cytokines (PMID: 20636820). Engagement of PD-1 by its ligands PD-L1 or PD-L2 transduces a signal that inhibits T-cell proliferation, cytokine production, and cytolytic function (PMID: 19426218). It is critical for the regulation of T cell function during immunity and tolerance. Blockade of PD-1 can overcome immune resistance and also has been shown to have antitumor activity (PMID: 22658127; 23169436). It has been reported that PD-1 is heavily glycosylated and migrates with an apparent molecular mass of 47-55 kDa on SDS-PAGE, which is larger than its predicted mass of 32 kDa (PMID: 8671665; 17640856; 17003438).

Protocols

Product Specific Protocols
WB protocol for PD-1/CD279 antibody 83516-6-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...