CoraLite® Plus 647 Anti-Mouse PD-1/CD279 Rabbit Recombinant Antibody

PD-1/CD279 Uni-rAb® Recombinant Antibody for FC
Cat No. CL647-98080
Clone No.240389B8

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

FC

CD279, PD1, PD-1, 240389B8, PD 1

Formulation:  PBS, Azide
PBS, Azide
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC detected inanti-CD3/CD28 treated mouse splenocytes

Recommended dilution

ApplicationDilution
Flow Cytometry (FC)FC : 0.25 ug per 10^6 cells in 100 μl suspension
This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL647-98080 targets PD-1/CD279 in FC applications and shows reactivity with mouse samples.

Tested Reactivity mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Eg0918

Product name: Recombinant mouse PD-1 protein

Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

Tag: C-6*HIS

Domain: 25-167 aa of NM_008798.2

Sequence: LEVPNGPWRSLTFYPAWLTVSEGANATFTCSLSNWSEDLMLNWNRLSPSNQTEKQAAFCNGLSQPVQDARFQIIQLPNRHDFHMNILDTRRNDSGIYLCGAISLHPKAKIEESPGAELVVTERILETSTRYPSPSPKPEGRFQ

Predict reactive species
Full Name programmed cell death 1
Calculated Molecular Weight32 kDa
GenBank Accession NumberNM_008798.2
Gene Symbol PD-1
Gene ID (NCBI) 18566
Conjugate CoraLite® Plus 647 Fluorescent Dye
Excitation/Emission Maxima Wavelengths654 nm / 674 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ02242
Storage Buffer PBS with 0.09% sodium azide, pH 7.3.
Storage ConditionsStore at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

Programmed cell death 1 (PD-1, also known as CD279) is an immunoinhibitory receptor that belongs to the CD28/CTLA-4 subfamily of the Ig superfamily. It is a 288 amino acid (aa) type I transmembrane protein composed of one Ig superfamily domain, a stalk, a transmembrane domain, and an intracellular domain containing an immunoreceptor tyrosine-based inhibitory motif (ITIM) as well as an immunoreceptor tyrosine-based switch motif (ITSM) (PMID: 18173375). PD-1 is expressed during thymic development and is induced in a variety of hematopoietic cells in the periphery by antigen receptor signaling and cytokines (PMID: 20636820). Engagement of PD-1 by its ligands PD-L1 or PD-L2 transduces a signal that inhibits T-cell proliferation, cytokine production, and cytolytic function (PMID: 19426218). It is critical for the regulation of T cell function during immunity and tolerance. Blockade of PD-1 can overcome immune resistance and also has been shown to have antitumor activity (PMID: 22658127; 23169436).

Protocols

Product Specific Protocols
FC protocol for CL Plus 647 PD-1/CD279 antibody CL647-98080Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...