FcZero-rAb® Biotin Anti-Human PD-L1/CD274 Rabbit Recombinant Antibody

• 

  FC experiment of human PBMCs using Biotin-FcA98062

  1x10^6 unstimulated or PHA-stimulated human PBMCs were surface stained with 0.25 ug Biotin Anti-Human PD-L1/CD274 Rabbit RecAb (Biotin-FcA98062, Clone: 240721H8) and Streptavidin-PE Conjugate (PE-PF00030). Cells were then stained with CoraLite® Plus 647 Anti-Human CD3 (OKT3) Mouse IgG2a Recombinant Antibody (CL647-65569, Clone: OKT3). Cells were not fixed.

• 

  FC experiment of human PBMCs using Biotin-FcA98062

  1x10^6 PHA-treated human PBMCs were surface stained with 0.25 ug Biotin Anti-Human PD-L1/CD274 Rabbit RecAb (Biotin-FcA98062, Clone: 240721H8)(red) or FcZero-rAb® Biotin Rabbit IgG Isotype Control Recombinant Antibody (Biotin-FcA98136, Clone: 240953C9) (blue), and Streptavidin-PE Conjugate (PE-PF00030). 1x10^6 unstimulated PBMCs were surface stained with 0.25 ug Biotin Anti-Human PD-L1/CD274 Rabbit RecAb (Biotin-FcA98062, Clone: 240721H8) (black, dashed) and Streptavidin-PE Conjugate (PE-PF00030). Cells were not fixed.

• Zero Fc receptor binding
• Site-specific conjugation
• One universal isotype

PD-L1/CD274 FcZero-rAb^® Recombinant Antibody for FC

Cat No. Biotin-FcA98062

Clone No.240721H8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

Synonyms

CD274, PD-L1, B7 H1, B7-H1, hPD-L1

---

Tested Applications

• Positive FC detected in: PHA treated human PBMCs

Recommended dilution

• Flow Cytometry (FC): FC : 0.25 ug per 10^6 cells in a 100 µl suspension

This reagent has been tested for flow cytometric analysis. It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

Biotin-FcA98062 targets PD-L1/CD274 in FC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg1114

  Product name: Recombinant human PD-L1/CD274 protein

  Source: mammalian cells-derived, pHZ-KIsec-C-6*HIS

  Tag: C-6*HIS

  Domain: 19-238 aa of BC074984

  Sequence: FTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQHSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYNKINQRILVVDPVTSEHELTCQAEGYPKAEVIWTSSDHQVLSGKTTTTNSKREEKLFNVTSTLRINTTTNEIFYCTFRRLDPEENHTAELVIPELPLAHPPNER

• Full Name: CD274 molecule
• Calculated Molecular Weight: 290 aa, 33 kDa
• GenBank Accession Number: BC074984
• Gene Symbol: PD-L1
• Gene ID (NCBI): 29126
• Conjugate: Biotin
• Excitation/Emission Maxima Wavelengths: -
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9NZQ7
• Storage Buffer: PBS with 0.09% sodium azide, pH 7.3.
• Storage Conditions: Store at 2-8°C. Avoid exposure to light. Stable for one year after shipment.

Background Information

Programmed cell death ligand 1 (PD-L1, CD274, or B7-H1), is the first member of B7 family to be discovered. B7 family molecules are type I transmembrane proteins belonging to the immunoglobulin superfamily. In concert with their CD28 family receptors, the B7s are key regulators of the adaptive immune response. PD-L1 is suggested as a negative regulator of T and B cell, and plays important role in mediating tolerance of lymphocytes to self-antigens. It is also involved in the costimulatory signal, essential for T-cell proliferation and production of IL10 and IFNG, in an IL2-dependent and a PD-1-independent manner.