PDAP1 Polyclonal antibody

• 

  WB analysis of MCF-7 using 15081-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 15081-1-AP (PDAP1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MCF-7 using 15081-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 15081-1-AP (PDAP1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IP experiment of MCF-7 using 15081-1-AP

  IP result of anti-PDAP1 (IP:15081-1-AP, 4ug; Detection:15081-1-AP 1:1000) with MCF-7 cells lysate 2400ug.

• 

  IHC staining of human breast cancer using 15081-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 15081-1-AP (PDAP1 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human breast cancer using 15081-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 15081-1-AP (PDAP1 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of MCF-7 using 15081-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed MCF-7 cells using PDAP1 antibody (15081-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2).

PDAP1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 15081-1-AP

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Synonyms

PDGF-associated protein, PDGFA-associated protein 1, PDGFA associated protein 1, PDGF associated protein, HASPP28

---

Tested Applications

• Positive WB detected in: MCF7 cells, MCF-7 cells
• Positive IP detected in: MCF-7 cells
• Positive IHC detected in: human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IHC: See 1 publications below
• CoIP: See 1 publications below

Product Information

15081-1-AP targets PDAP1 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7155

  Product name: Recombinant human PDAP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-181 aa of BC000684

  Sequence: MPKGGRKGGHKGRARQYTSPEEIDAQLQAEKQKAREEEEQKEGGDGAAGDPKKEKKSLDSDESEDEEDDYQQKRKGVEGLIDIENPNRVAQTTKKVTQLDLDGPKELSRREREEIEKQKAKERYMKMHLAGKTEQAKADLARLAIIRKQREEAARKKEEERKAKDDATLSGKRMQSLSLNK

• Full Name: PDGFA associated protein 1
• Calculated Molecular Weight: 21 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC000684
• Gene Symbol: PDAP1
• Gene ID (NCBI): 11333
• RRID: AB_2159306
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13442
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	Proteomics Clin Appl; SILAC-based quantitative proteomic analysis of gastric cancer secretome.; Authors - Marimuthu Arivusudar A
human	WB	Cancer Sci; Pancreatic ductal adenocarcinoma cells regulated the gemcitabine-resistance function of CAFs by LINC00460; Authors - Xiao‐Xu Zhu
human		Heliyon; Single-cell RNA-Seq reveals the heterogeneity of fibroblasts within the tympanojugular paraganglioma microenvironment; Authors - Shengming Wang
human,mouse	WB,CoIP	Sci Adv; Hepatovirus translation requires PDGFA-associated protein 1, an eIF4E-binding protein regulating endoplasmic reticulum stress responses; Authors - Takayoshi Shirasaki