PDAP1 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PDAP1 Polyclonal antibody (15081-1-AP)

PDAP1 Polyclonal Antibody for WB, ELISA

Cat No. 15081-1-AP

Publications(5)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, CoIP, ELISA

Synonyms

28 kDa heat- and acid-stable phosphoprotein, HASPP28, PDGF associated protein, PDGFA associated protein 1, PDGFA-associated protein 1

• 

  WB analysis using 15081-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15081-1-AP (PDAP1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15081-1-AP targets PDAP1 in WB, IHC, CoIP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7155

  Product name: Recombinant human PDAP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-181 aa of BC000684

  Sequence: MPKGGRKGGHKGRARQYTSPEEIDAQLQAEKQKAREEEEQKEGGDGAAGDPKKEKKSLDSDESEDEEDDYQQKRKGVEGLIDIENPNRVAQTTKKVTQLDLDGPKELSRREREEIEKQKAKERYMKMHLAGKTEQAKADLARLAIIRKQREEAARKKEEERKAKDDATLSGKRMQSLSLNK

• Full Name: PDGFA associated protein 1
• Calculated Molecular Weight: 21 kDa
• Observed Molecular Weight: 28 kDa
• GenBank Accession Number: BC000684
• Gene Symbol: PDAP1
• Gene ID (NCBI): 11333
• RRID: AB_2159306
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13442
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PDAP1 (PDGFA-associated protein 1), also known as PAP, PAP1, or HASPP28 (28 kDa heat- and acid-stable phosphoprotein), is a protein-coding gene located on human chromosome 7q22.1 . The gene consists of 6 exons and encodes a 28 kDa phosphoprotein that is highly conserved across vertebrate species.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse,human	WB,CoIP	Sci Adv; Hepatovirus translation requires PDGFA-associated protein 1, an eIF4E-binding protein regulating endoplasmic reticulum stress responses; Authors - Takayoshi Shirasaki
human	WB	Cancer Sci; Pancreatic ductal adenocarcinoma cells regulated the gemcitabine-resistance function of CAFs by LINC00460; Authors - Xiao‐Xu Zhu
human	IHC	Proteomics Clin Appl; SILAC-based quantitative proteomic analysis of gastric cancer secretome.; Authors - Marimuthu Arivusudar A
human		Heliyon; Single-cell RNA-Seq reveals the heterogeneity of fibroblasts within the tympanojugular paraganglioma microenvironment; Authors - Shengming Wang
		Stem Cell Res Ther; Exosomal miR-181d-5p derived from distal airway stem cells inhibit apoptosis of pulmonary vascular endothelial cells in COPD mice by targeting PDAP1.; Authors - Qing Song

Reviews

4.0 out of 5

1 verified customer reviews

What customers say

Automatically generated from the verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

MALLIKARJUNA (Verified Customer) (11-13-2025)

good for western blot

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: liver tissue