• Featured Product
  • KD/KO Validated

PDCD4 Polyclonal antibody

PDCD4 Polyclonal Antibody for WB, IHC, FC (Intra), IP, ELISA
Cat No. 12587-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, FC (Intra), IP, ELISA

Dug, H731, Nuclear antigen H731-like, PDCD 4, Tis

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inBxPC-3 cells, MCF-7 cells, HEK293 cells, HEK-293 cells, HeLa cells
Positive IP detected inHeLa cells
Positive IHC detected inhuman breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:4000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:20-1:200
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

12587-1-AP targets PDCD4 in WB, IHC, IF, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag3288

Product name: Recombinant human PDCD4 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 169-469 aa of BC026104

Sequence: TPIIQEYFEHGDTNEVAEMLRDLNLGEMKSGVPVLAVSLALEGKASHREMTSKLLSDLCGTVMSTTDVEKSFDKLLKDLPELALDTPRAPQLVGQFIARAVGDGILCNTYIDSYKGTVDCVQARAALDKATVLLSMSKGGKRKDSVWGSGGGQQSVNHLVKEIDMLLKEYLLSGDISEAEHCLKELEVPHFHHELVYEAIIMVLESTGESTFKMILDLLKSLWKSSTITVDQMKRGYERIYNEIPDINLDVPHSYSVLERFVEECFQAGIISKQLRDLCPSRGRKRFVSEGDGGRLKPESY

Predict reactive species
Full Name programmed cell death 4 (neoplastic transformation inhibitor)
Calculated Molecular Weight 469 aa, 52 kDa
Observed Molecular Weight 54-64 kDa
GenBank Accession NumberBC026104
Gene Symbol PDCD4
Gene ID (NCBI) 27250
RRIDAB_2162296
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ53EL6
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Programmed cell death 4 (Pdcd4) is a novel tumor suppressor that inhibits translation, progression and invasion. It was first identified as being differnetially upregulated during apoptosis. Pdcd4 interferes with the activity of the eukaryotic initiation factor (eIF) 4A by displacing the scaffold protein eIF4G from its binding to the RNA helicase eIF4A. The calculated molecular wight of unmodified PDCD4 protein is 52 kDa, but the modified protein is about 54-64 kDa.

Protocols

Product Specific Protocols
IHC protocol for PDCD4 antibody 12587-1-APDownload protocol
IP protocol for PDCD4 antibody 12587-1-APDownload protocol
WB protocol for PDCD4 antibody 12587-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB,IHC

J Nanobiotechnology

Cold exposure protects against medial arterial calcification development via autophagy

Authors - Fu-Xing-Zi Li
humanWB

Oncogene

miR-21a in exosomes from Lewis lung carcinoma cells accelerates tumor growth through targeting PDCD4 to enhance expansion of myeloid-derived suppressor cells.

Authors - Xingju Zhang
  • KD Validated
mouseWB,IHC

Clin Transl Med

Phosphoproteome reveals molecular mechanisms of aberrant rhythm in neurotransmitter-mediated islet hormone secretion in diabetic mice.

Authors - Yunqiang He
ratWB

Biomed Pharmacother

MiR-208a-3p aggravates autophagy through the PDCD4-ATG5 pathway in Ang II-induced H9c2 cardiomyoblasts.

Authors - Li Wang
  • KD Validated
rat,mouseWB,IHC,IF

Oxid Med Cell Longev

Protective Effects of PPARγ on Renal Ischemia-Reperfusion Injury by Regulating miR-21

Authors - Ruizhen Huang

Cell Cycle

Resveratrol prevents rapamycin-induced upregulation of autophagy and selectively induces apoptosis in TSC2-deficient cells.

Authors - Anya Alayev
Loading...
||
New chat Able
正在加载,请稍候...