PDCD6/ALG2 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85792-5-RR (same clone as 85792-5-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85792-5-RR (PDCD6/ALG2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85792-5-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 85792-5-RR (same clone as 85792-5-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 85792-5-RR (PDCD6/ALG2 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85792-5-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 85792-5-RR

  Biolayer interferometry (BLl) kinetic assays of 85792-5-RR against Human PDCD6/ALG2 were performed. The affinity constant is 5.93 nM.

PDCD6/ALG2 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 85792-5-PBS

Clone No.250087B4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

ALG2, PDCD6, ALG 2, ALG-2, Apoptosis-linked gene 2 protein homolog

---

Product Information

85792-5-PBS targets PDCD6/ALG2 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag2949

  Product name: Recombinant human PDCD6 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-191 aa of BC012384

  Sequence: MAAYSYRPGPGAGPGPAAGAALPDQSFLWNVFQRVDKDRSGVISDTELQQALSNGTWTPFNPVTVRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVFSIV

• Full Name: programmed cell death 6
• Calculated Molecular Weight: 191 aa, 22 kDa
• Observed Molecular Weight: 15-22 kDa
• GenBank Accession Number: BC012384
• Gene Symbol: PDCD6
• Gene ID (NCBI): 10016
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O75340
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Programmed cell death protein 6 (PDCD6) is also named as ALG2. PDCD6 is an evolutionarily conserved Ca2+-binding protein. PDCD6 is required for coat protein complex II-dependent endoplasmic reticulum-to-Golgi apparatus vesicular transport in the cytoplasm (PMID: 39934130). PDCD6 is involved in regulating multifaceted and pleiotropic cellular processes in different cellular compartments. The nuclear PDCD6 regulates apoptosis and alternative splicing. And cytoplasmic PDCD6 is involved in the regulation of cytoskeletal dynamics and innate immune responses. Additionally, membranous PDCD6 participates in membrane repair through endosomal sorting complex required for transport complex-dependent membrane budding. (PMID: 38436472). PDCD6 also acts as a regulator of cytosolic DNA-induced immune responses by modulating STING transport (PMID: 34787301).