PDCD6/ALG2 Recombinant monoclonal antibody

PDCD6/ALG2 Uni-rAb® Recombinant Antibody for WB, ELISA
Cat No. 85792-5-RR
Clone No.250087B4

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

ALG2, PDCD6, ALG 2, ALG-2, Apoptosis-linked gene 2 protein homolog

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHepG2 cells, HeLa cells, HEK-293 cells, K-562 cells, SK-BR-3 cells, NIH/3T3 cells, HSC-T6 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

85792-5-RR targets PDCD6/ALG2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag2949

Product name: Recombinant human PDCD6 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-191 aa of BC012384

Sequence: MAAYSYRPGPGAGPGPAAGAALPDQSFLWNVFQRVDKDRSGVISDTELQQALSNGTWTPFNPVTVRSIISMFDRENKAGVNFSEFTGVWKYITDWQNVFRTYDRDNSGMIDKNELKQALSGFGYRLSDQFHDILIRKFDRQGRGQIAFDDFIQGCIVLQRLTDIFRRYDTDQDGWIQVSYEQYLSMVFSIV

Predict reactive species
Full Name programmed cell death 6
Calculated Molecular Weight 191 aa, 22 kDa
Observed Molecular Weight 15-22 kDa
GenBank Accession NumberBC012384
Gene Symbol PDCD6
Gene ID (NCBI) 10016
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO75340
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Programmed cell death protein 6 (PDCD6) is also named as ALG2. PDCD6 is an evolutionarily conserved Ca2+-binding protein. PDCD6 is required for coat protein complex II-dependent endoplasmic reticulum-to-Golgi apparatus vesicular transport in the cytoplasm (PMID: 39934130). PDCD6 is involved in regulating multifaceted and pleiotropic cellular processes in different cellular compartments. The nuclear PDCD6 regulates apoptosis and alternative splicing. And cytoplasmic PDCD6 is involved in the regulation of cytoskeletal dynamics and innate immune responses. Additionally, membranous PDCD6 participates in membrane repair through endosomal sorting complex required for transport complex-dependent membrane budding. (PMID: 38436472). PDCD6 also acts as a regulator of cytosolic DNA-induced immune responses by modulating STING transport (PMID: 34787301).

Protocols

Product Specific Protocols
WB protocol for PDCD6/ALG2 antibody 85792-5-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...