PDCD7 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PDCD7 Polyclonal antibody, PBS Only (12485-1-PBS)

• 

  WB analysis of HeLa using 12485-1-AP (same clone as 12485-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 12485-1-AP (PDCD7 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12485-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 12485-1-AP (same clone as 12485-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 12485-1-AP (PDCD7 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12485-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 12485-1-AP (same clone as 12485-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 12485-1-AP (PDCD7 antibody) at dilution of 1:0 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12485-1-PBS in a different storage buffer formulation.

PDCD7 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 12485-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

12485-1-PBS targets PDCD7 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3175

  Product name: Recombinant human PDCD7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 340-485 aa of BC016992

  Sequence: PPASADETFTHHLQRLRKLIKKRSELYEAEERALRVMLEGEQEEERKRELEKKQRKEKEKILLQKREIESKLFGDPDEFPLAHLLEPFRQYYLQAEHSLPALIQIRHDWDQYLVPSDHPKGNFVPQGWVLPPLPSNDIWATAVKLH

• Full Name: programmed cell death 7
• Calculated Molecular Weight: 485 aa, 55 kDa
• Observed Molecular Weight: 55 kDa
• GenBank Accession Number: BC016992
• Gene Symbol: PDCD7
• Gene ID (NCBI): 10081
• RRID: AB_2162745
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N8D1
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.