PDCL Polyclonal antibody

• Home
• Products
• Primary Antibodies
• PDCL Polyclonal antibody (16057-1-AP)

PDCL Polyclonal Antibody for WB, IHC, ELISA

Cat No. 16057-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

PDCL, PhLP, phosducin like, Phosducin like protein

• 

  WB analysis using 16057-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16057-1-AP (PDCL antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of NCI-H1299 using 16057-1-AP

  NCI-H1299 cells were subjected to SDS PAGE followed by western blot with 16057-1-AP (PDCL antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 16057-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta using 16057-1-AP (PDCL antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human placenta using 16057-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta using 16057-1-AP (PDCL antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 16057-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 16057-1-AP (PDCL antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for PDCL in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HEK-293 cells, NCI-H1299 cells, Jurkat cells
• Positive IHC detected in: human placenta tissue, mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16057-1-AP targets PDCL in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9029

  Product name: Recombinant human PDCL protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-301 aa of BC017227

  Sequence: MTTLDDKLLGEKLQYYYSSSEDEDSDHEDKDRGRCAPASSSVPAEAELAGEGISVNTGPKGVINDWRRFKQLETEQREEQCREMERLIKKLSMTCRSHLDEEEEQQKQKDLQEKISGKMTLKEFAIMNEDQDDEEFLQQYRKQRMEEMRQQLHKGPQFKQVFEISSGEGFLDMIDKEQKSIVIMVHIYEDGIPGTEAMNGCMICLAAEYPAVKFCKVKSSVIGASSQFTRNALPALLIYKGGELIGNFVRVTDQLGDDFFAVDLEAFLQEFGLLPEKEVLVLTSVRNSATCHSEDSDLEID

• Full Name: phosducin-like
• Calculated Molecular Weight: 301 aa, 34 kDa
• Observed Molecular Weight: 40-42 kDa
• GenBank Accession Number: BC017227
• Gene Symbol: PDCL
• Gene ID (NCBI): 5082
• RRID: AB_2236943
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13371
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The anti-PDCL polyclonal antibody (Cat# 16057-1-AP) has 1 citation to date. It was cited in Acta Physiol (Oxf) in a 2024 study investigating ATP6V1A's role in synaptic rearrangements and plasticity in murine hippocampal neurons. The research falls within the neuroscience field, specifically examining ion channel function in neuronal plasticity. The antibody was used for Western blot analysis in rat samples.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	WB	Acta Physiol (Oxf); ATP6V1A is required for synaptic rearrangements and plasticity in murine hippocampal neurons; Authors - Alessandro Esposito