PDE3B Recombinant monoclonal antibody

• 

  WB analysis using 85996-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 85996-1-RR (PDE3B antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse adipose using 85996-1-RR

  Mouse adipose tissue were subjected to SDS PAGE followed by western blot with 85996-1-RR (PDE3B antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse adipose using 85996-1-RR

  Immunohistochemical analysis of paraffin-embedded mouse adipose tissue slide using 85996-1-RR (PDE3B antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse adipose using 85996-1-RR

  Immunohistochemical analysis of paraffin-embedded mouse adipose tissue slide using 85996-1-RR (PDE3B antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  Affinity and Kinetic Characterization of 85996-1-RR

  Biolayer interferometry (BLl) kinetic assays of 85996-1-RR against Human PDE3B were performed. The affinity constant is below 1 pM.

PDE3B Uni-rAb^® Recombinant Antibody for WB, IHC, ELISA

Cat No. 85996-1-RR

Clone No.250460H7

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, ELISA

Synonyms

CGIP1, CGI-PDE B, cGIPDE1, cGMP-inhibited 3',5'-cyclic phosphodiesterase 3B, Cyclic GMP-inhibited phosphodiesterase B

---

Tested Applications

• Positive WB detected in: HeLa cells, mouse adipose tissue, Jurkat cells
• Positive IHC detected in: mouse adipose tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

85996-1-RR targets PDE3B in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag19190

  Product name: Recombinant human PDE3B protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 321-670 aa of BC136565

  Sequence: CISREQMILWDWDLKQWYKPHYQNSGGGNGVDLSVLNEARNMVSDLLTDPSLPPQVISSLRSISSLMGAFSGSCRPKINPLTPFPGFYPCSEIEDPAEKGDRKLNKGLNRNSLPTPQLRRSSGTSGLLPVEQSSRWDRNNGKRPHQEFGISSQGCYLNGPFNSNLLTIPKQRSSSVSLTHHVGLRRAGVLSSLSPVNSSNHGPVSTGSLTNRSPIEFPDTADFLNKPSVILQRSLGNAPNTPDFYQQLRNSDSNLCNSCGHQMLKYVSTSESDGTDCCSGKSGEEENIFSKESFKLMETQQEEETEKKDSRKLFQEGDKWLTEEAQSEQQTNIEQEVSLDLILVEEYDSL

• Full Name: phosphodiesterase 3B, cGMP-inhibited
• Calculated Molecular Weight: 1112 aa, 124 kDa
• Observed Molecular Weight: 124 kDa
• GenBank Accession Number: BC136565
• Gene Symbol: PDE3B
• Gene ID (NCBI): 5140
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q13370
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

PDE3B is a cyclic nucleotide phosphodiesterase with dual specificity for cAMP and cGMP. It plays crucial roles in regulating physiological processes such as angiogenesis and cardiac contractility. PDE3B can be activated by insulin and is involved in the antilipolytic actions of insulin. Additionally, PDE3B forms macromolecular complexes that are important for its activation and interaction with other proteins (PMID: 22001403, PMID: 26031333).