PDE4B Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• PDE4B Polyclonal antibody, PBS Only (31730-1-PBS)

• 

  WB analysis using 31730-1-AP (same clone as 31730-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31730-1-AP (PDE4B antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31730-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 31730-1-AP (same clone as 31730-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 31730-1-AP (PDE4B antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31730-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 31730-1-AP (same clone as 31730-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 31730-1-AP (PDE4B antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31730-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 31730-1-AP (same clone as 31730-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 31730-1-AP (PDE4B antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31730-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 31730-1-AP (same clone as 31730-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 31730-1-AP (PDE4B antibody) at dilution of 1:400 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31730-1-PBS in a different storage buffer formulation.

PDE4B Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 31730-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

DPDE4, PDE32, PDE4B5, PDEIVB

---

Product Information

31730-1-PBS targets PDE4B in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35552

  Product name: Recombinant human PDE4B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 651-736 aa of BC105040

  Sequence: WYQSMIPQSPSPPLDEQNRDCQGLMEKFQFELTLDEEDSEGPEKEGEGHSYFSSTKTLCVIDPENRDSLGETDIDIATEDKSPVDT

• Full Name: phosphodiesterase 4B, cAMP-specific (phosphodiesterase E4 dunce homolog, Drosophila)
• Calculated Molecular Weight: 736 aa, 83 kDa
• Observed Molecular Weight: 83 kDa
• GenBank Accession Number: BC105040
• Gene Symbol: PDE4B
• Gene ID (NCBI): 5142
• RRID: AB_3670101
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q07343
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PDE4B, also known as DPDE4, is a member of the PDE family of type IV cAMP-specific cyclic nucleotides. PDE4B regulates the cellular concentration of cyclic nucleotides and thus plays a role in signal transduction of inflammatory factors. Among all subtypes of PDE4, PDE4B is closely associated with cancer and has a major contribution to the role in hematological malignancies. PDE4B is distributed in multiple tissues, especially myeloid cells (PMID: 35899614, PMID: 36278172).